Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UD00

Protein Details
Accession M2UD00   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
56-79YGGWVEKEERRKRRELRELNELKRBasic
NLS Segment(s)
PositionSequence
65-70RRKRRE
Subcellular Location(s) cyto 12.5, cyto_mito 10.333, mito 7, mito_nucl 5.333, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032710  NTF2-like_dom_sf  
IPR039544  Tim44-like  
IPR007379  Tim44-like_dom  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF04280  Tim44  
Amino Acid Sequences VGQGAAWTWDTMPVKGVRAAARVTGSGIEYATRPVRQTKAFQAVKETIDDGSSSRYGGWVEKEERRKRRELRELNELKRTGGKALGPMEEDPNAGTNVTLHKDAKYKEVWREWKDNSKLAQGFFNMKAVYRESDNPLIETARSISDRITGFFAENETAMVIKKFREMDPNFQMESFLTEMREYILPEVLDAYVKGDVAVLKEWLSAAQYSVYAALMQQYQAAGLKSDGKIVDIRGVDVLNAKLLEPGEIPVFILTCRTQEVHVYRNAKSGELASGMDDKVQQVTYAIGVTRIPEDVNNPETRGWRLIELQKSARDYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.3
4 0.26
5 0.28
6 0.29
7 0.27
8 0.27
9 0.24
10 0.23
11 0.2
12 0.18
13 0.15
14 0.14
15 0.12
16 0.11
17 0.15
18 0.18
19 0.18
20 0.2
21 0.25
22 0.3
23 0.34
24 0.39
25 0.43
26 0.5
27 0.51
28 0.5
29 0.52
30 0.5
31 0.47
32 0.43
33 0.35
34 0.25
35 0.22
36 0.21
37 0.15
38 0.15
39 0.14
40 0.12
41 0.11
42 0.12
43 0.12
44 0.14
45 0.17
46 0.2
47 0.25
48 0.33
49 0.43
50 0.52
51 0.6
52 0.64
53 0.7
54 0.72
55 0.77
56 0.81
57 0.8
58 0.76
59 0.78
60 0.82
61 0.77
62 0.76
63 0.66
64 0.56
65 0.5
66 0.45
67 0.36
68 0.29
69 0.25
70 0.22
71 0.24
72 0.24
73 0.21
74 0.21
75 0.21
76 0.19
77 0.18
78 0.14
79 0.13
80 0.11
81 0.1
82 0.08
83 0.07
84 0.1
85 0.11
86 0.14
87 0.13
88 0.15
89 0.2
90 0.21
91 0.25
92 0.28
93 0.31
94 0.36
95 0.44
96 0.5
97 0.51
98 0.57
99 0.56
100 0.6
101 0.59
102 0.57
103 0.5
104 0.49
105 0.46
106 0.39
107 0.37
108 0.29
109 0.3
110 0.25
111 0.26
112 0.18
113 0.16
114 0.17
115 0.16
116 0.16
117 0.14
118 0.16
119 0.18
120 0.22
121 0.22
122 0.21
123 0.2
124 0.2
125 0.17
126 0.15
127 0.12
128 0.09
129 0.09
130 0.09
131 0.08
132 0.12
133 0.13
134 0.13
135 0.13
136 0.12
137 0.12
138 0.11
139 0.12
140 0.08
141 0.08
142 0.07
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.08
150 0.1
151 0.1
152 0.2
153 0.22
154 0.29
155 0.33
156 0.36
157 0.34
158 0.32
159 0.32
160 0.22
161 0.22
162 0.15
163 0.11
164 0.08
165 0.08
166 0.08
167 0.09
168 0.1
169 0.08
170 0.08
171 0.09
172 0.08
173 0.08
174 0.09
175 0.07
176 0.07
177 0.06
178 0.07
179 0.05
180 0.05
181 0.05
182 0.05
183 0.06
184 0.07
185 0.08
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.05
200 0.05
201 0.06
202 0.06
203 0.06
204 0.06
205 0.06
206 0.06
207 0.08
208 0.08
209 0.07
210 0.08
211 0.12
212 0.12
213 0.15
214 0.14
215 0.14
216 0.15
217 0.15
218 0.19
219 0.15
220 0.16
221 0.14
222 0.14
223 0.13
224 0.14
225 0.14
226 0.1
227 0.1
228 0.1
229 0.11
230 0.11
231 0.11
232 0.09
233 0.11
234 0.1
235 0.1
236 0.1
237 0.08
238 0.08
239 0.07
240 0.1
241 0.09
242 0.09
243 0.11
244 0.12
245 0.13
246 0.2
247 0.24
248 0.26
249 0.33
250 0.36
251 0.35
252 0.41
253 0.41
254 0.34
255 0.31
256 0.27
257 0.22
258 0.19
259 0.19
260 0.14
261 0.16
262 0.16
263 0.15
264 0.15
265 0.13
266 0.14
267 0.14
268 0.12
269 0.1
270 0.1
271 0.1
272 0.11
273 0.1
274 0.09
275 0.09
276 0.11
277 0.11
278 0.11
279 0.11
280 0.11
281 0.15
282 0.19
283 0.25
284 0.26
285 0.26
286 0.29
287 0.31
288 0.33
289 0.33
290 0.29
291 0.27
292 0.32
293 0.39
294 0.43
295 0.47
296 0.48
297 0.5