Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2U5B9

Protein Details
Accession M2U5B9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-39AATGRRASRTPKARKSRLSERPRTASHydrophilic
NLS Segment(s)
PositionSequence
18-36RRASRTPKARKSRLSERPR
Subcellular Location(s) mito 16, extr 7, nucl 4
Family & Domain DBs
Amino Acid Sequences MGRLLLLPLPLPLAATGRRASRTPKARKSRLSERPRTASGQGGKAPPTTATANANTNPNCTEAVHQRLSPASARPHQPTDRAPSTPSALHRSVEVRSVSDTTTLTTHPFSQNAHSGRTSALLLYLCSCASQCADMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.17
4 0.2
5 0.23
6 0.24
7 0.3
8 0.37
9 0.46
10 0.53
11 0.61
12 0.68
13 0.74
14 0.8
15 0.83
16 0.84
17 0.84
18 0.84
19 0.83
20 0.81
21 0.79
22 0.73
23 0.68
24 0.59
25 0.56
26 0.49
27 0.44
28 0.39
29 0.35
30 0.33
31 0.29
32 0.28
33 0.21
34 0.2
35 0.17
36 0.15
37 0.16
38 0.17
39 0.19
40 0.2
41 0.24
42 0.21
43 0.21
44 0.2
45 0.19
46 0.17
47 0.15
48 0.17
49 0.16
50 0.22
51 0.22
52 0.21
53 0.2
54 0.2
55 0.21
56 0.19
57 0.17
58 0.16
59 0.19
60 0.22
61 0.25
62 0.3
63 0.31
64 0.33
65 0.33
66 0.37
67 0.37
68 0.34
69 0.32
70 0.29
71 0.29
72 0.29
73 0.28
74 0.26
75 0.24
76 0.23
77 0.23
78 0.23
79 0.22
80 0.24
81 0.21
82 0.16
83 0.17
84 0.18
85 0.17
86 0.17
87 0.16
88 0.12
89 0.13
90 0.13
91 0.13
92 0.13
93 0.16
94 0.17
95 0.18
96 0.18
97 0.21
98 0.29
99 0.29
100 0.31
101 0.28
102 0.27
103 0.26
104 0.26
105 0.22
106 0.15
107 0.15
108 0.12
109 0.12
110 0.13
111 0.14
112 0.12
113 0.12
114 0.12
115 0.11
116 0.11