Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2UWB6

Protein Details
Accession M2UWB6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
60-82HEEQIRTRKKEKKAVQHQRTSGPBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 2
Family & Domain DBs
Amino Acid Sequences MAEFNLADNYNSTDHLFLLLHQMSFPLIPLPSGLKPQAPNQPTPTHGPFPPGRSFLLVEHEEQIRTRKKEKKAVQHQRTSGPAHGCKNKGEEEDTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.13
4 0.1
5 0.16
6 0.16
7 0.15
8 0.14
9 0.14
10 0.13
11 0.13
12 0.13
13 0.07
14 0.06
15 0.06
16 0.07
17 0.1
18 0.11
19 0.13
20 0.14
21 0.15
22 0.17
23 0.22
24 0.3
25 0.29
26 0.3
27 0.32
28 0.33
29 0.33
30 0.36
31 0.35
32 0.3
33 0.28
34 0.29
35 0.27
36 0.29
37 0.3
38 0.26
39 0.23
40 0.21
41 0.22
42 0.19
43 0.22
44 0.19
45 0.17
46 0.18
47 0.18
48 0.17
49 0.17
50 0.23
51 0.25
52 0.28
53 0.35
54 0.41
55 0.49
56 0.59
57 0.66
58 0.71
59 0.75
60 0.83
61 0.84
62 0.85
63 0.81
64 0.77
65 0.73
66 0.66
67 0.6
68 0.56
69 0.53
70 0.52
71 0.55
72 0.52
73 0.5
74 0.51
75 0.51
76 0.46