Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2V6J5

Protein Details
Accession M2V6J5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-72RICIWTTTRSRRYRRLLRAPCSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MGTANVKRRMDIPQPASHNHPSALFADQSWMPDTLNAHAASRNMFPIAMRICIWTTTRSRRYRRLLRAPCSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.56
4 0.53
5 0.47
6 0.38
7 0.33
8 0.27
9 0.24
10 0.23
11 0.17
12 0.13
13 0.14
14 0.13
15 0.13
16 0.13
17 0.12
18 0.1
19 0.1
20 0.11
21 0.1
22 0.13
23 0.12
24 0.11
25 0.11
26 0.12
27 0.12
28 0.12
29 0.12
30 0.09
31 0.09
32 0.08
33 0.12
34 0.13
35 0.13
36 0.13
37 0.14
38 0.15
39 0.17
40 0.18
41 0.18
42 0.24
43 0.32
44 0.42
45 0.49
46 0.57
47 0.64
48 0.73
49 0.8
50 0.83
51 0.84
52 0.85