Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2TU46

Protein Details
Accession M2TU46    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-50VSLGKQRRYRSKSRSGRRPASTHydrophilic
NLS Segment(s)
PositionSequence
35-45RRYRSKSRSGR
Subcellular Location(s) mito 20, nucl 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MFIGRCTGGHVQWAATLLFRWWKRGMFDVSLGKQRRYRSKSRSGRRPASTTCGRGDGFFLHAVDRLVSRSAMGASADGDGGKAEKKSRPGSMSCAGPRPGALARVAGLGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.13
4 0.11
5 0.18
6 0.18
7 0.22
8 0.23
9 0.25
10 0.27
11 0.32
12 0.35
13 0.29
14 0.34
15 0.36
16 0.37
17 0.43
18 0.43
19 0.4
20 0.4
21 0.43
22 0.49
23 0.49
24 0.55
25 0.55
26 0.64
27 0.71
28 0.77
29 0.82
30 0.81
31 0.83
32 0.78
33 0.75
34 0.67
35 0.64
36 0.59
37 0.51
38 0.42
39 0.37
40 0.32
41 0.26
42 0.25
43 0.18
44 0.15
45 0.13
46 0.12
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.06
61 0.06
62 0.06
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.07
69 0.08
70 0.11
71 0.15
72 0.22
73 0.26
74 0.32
75 0.36
76 0.37
77 0.43
78 0.44
79 0.49
80 0.45
81 0.47
82 0.43
83 0.39
84 0.36
85 0.33
86 0.3
87 0.24
88 0.22
89 0.17
90 0.16