Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2B0S5

Protein Details
Accession B2B0S5   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
224-244AIAFMIRRRRKKEPIPRTEDAHydrophilic
NLS Segment(s)
PositionSequence
230-236RRRRKKE
Subcellular Location(s) nucl 6mito 6mito_nucl 6, cyto 4, golg 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pan:PODANSg6553  -  
CDD cd12087  TM_EGFR-like  
Amino Acid Sequences MGKRQLSPMGLQARQEGEGSQLLPAMCFSLCDSAYMEAQRLVKTAELCSKDAAFLSIFGNCTACIKDNSNDTKYSEIEKGYIKPNFQPWLDYCEALPAIPISATSGPTKMIEFPADYFDTVTKTYWKQTLLGPNSITSFLETVTQILPNLKSFNLTDPQETTSTTFSNATTTSLSSSTSTSATATQSVSELELDQSGTPTTLNRSSLIGVIVGSVIGGLLLLGAIAFMIRRRRKKEPIPRTEDANDGKDEVWGKAQLHGDSIPVKPKTSPQELPNSWLRELPDSGFRELPLGSDSTELPISPMSKELQGSQGLPRYELDGGCAHFEKREGGGRGEML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.24
4 0.19
5 0.2
6 0.19
7 0.15
8 0.16
9 0.14
10 0.14
11 0.14
12 0.12
13 0.09
14 0.1
15 0.11
16 0.13
17 0.13
18 0.14
19 0.16
20 0.16
21 0.19
22 0.19
23 0.19
24 0.18
25 0.2
26 0.2
27 0.19
28 0.18
29 0.18
30 0.19
31 0.22
32 0.26
33 0.27
34 0.28
35 0.29
36 0.28
37 0.26
38 0.25
39 0.22
40 0.15
41 0.13
42 0.13
43 0.12
44 0.12
45 0.12
46 0.12
47 0.11
48 0.12
49 0.12
50 0.14
51 0.15
52 0.18
53 0.21
54 0.29
55 0.35
56 0.37
57 0.37
58 0.37
59 0.37
60 0.35
61 0.35
62 0.3
63 0.24
64 0.23
65 0.24
66 0.26
67 0.3
68 0.32
69 0.3
70 0.3
71 0.35
72 0.38
73 0.35
74 0.36
75 0.3
76 0.35
77 0.34
78 0.31
79 0.25
80 0.24
81 0.23
82 0.19
83 0.17
84 0.1
85 0.08
86 0.08
87 0.08
88 0.07
89 0.08
90 0.1
91 0.1
92 0.1
93 0.11
94 0.12
95 0.13
96 0.11
97 0.12
98 0.12
99 0.12
100 0.12
101 0.15
102 0.15
103 0.15
104 0.14
105 0.13
106 0.13
107 0.13
108 0.13
109 0.13
110 0.13
111 0.16
112 0.18
113 0.19
114 0.19
115 0.22
116 0.31
117 0.31
118 0.33
119 0.31
120 0.29
121 0.29
122 0.28
123 0.23
124 0.14
125 0.11
126 0.08
127 0.09
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.09
135 0.09
136 0.1
137 0.09
138 0.1
139 0.11
140 0.13
141 0.17
142 0.17
143 0.17
144 0.17
145 0.19
146 0.18
147 0.18
148 0.17
149 0.13
150 0.13
151 0.12
152 0.12
153 0.1
154 0.1
155 0.1
156 0.1
157 0.09
158 0.09
159 0.09
160 0.08
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.09
167 0.08
168 0.09
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.06
178 0.05
179 0.06
180 0.06
181 0.05
182 0.06
183 0.06
184 0.05
185 0.05
186 0.05
187 0.08
188 0.1
189 0.11
190 0.12
191 0.13
192 0.13
193 0.14
194 0.13
195 0.11
196 0.08
197 0.07
198 0.06
199 0.05
200 0.04
201 0.03
202 0.02
203 0.02
204 0.02
205 0.01
206 0.01
207 0.01
208 0.01
209 0.01
210 0.01
211 0.01
212 0.02
213 0.02
214 0.05
215 0.14
216 0.21
217 0.29
218 0.36
219 0.45
220 0.54
221 0.65
222 0.74
223 0.76
224 0.8
225 0.82
226 0.77
227 0.75
228 0.68
229 0.64
230 0.56
231 0.48
232 0.38
233 0.31
234 0.28
235 0.24
236 0.23
237 0.18
238 0.16
239 0.16
240 0.16
241 0.2
242 0.23
243 0.2
244 0.21
245 0.21
246 0.2
247 0.2
248 0.22
249 0.24
250 0.22
251 0.23
252 0.22
253 0.29
254 0.34
255 0.39
256 0.43
257 0.4
258 0.5
259 0.5
260 0.54
261 0.55
262 0.52
263 0.45
264 0.42
265 0.38
266 0.31
267 0.32
268 0.29
269 0.3
270 0.29
271 0.31
272 0.3
273 0.28
274 0.26
275 0.24
276 0.22
277 0.16
278 0.14
279 0.11
280 0.12
281 0.12
282 0.13
283 0.14
284 0.12
285 0.12
286 0.13
287 0.14
288 0.13
289 0.15
290 0.14
291 0.17
292 0.18
293 0.19
294 0.21
295 0.23
296 0.24
297 0.27
298 0.31
299 0.29
300 0.29
301 0.28
302 0.26
303 0.27
304 0.25
305 0.22
306 0.19
307 0.2
308 0.23
309 0.24
310 0.22
311 0.2
312 0.22
313 0.22
314 0.22
315 0.29
316 0.28
317 0.3