Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KG17

Protein Details
Accession R0KG17   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
25-52GSSVIPKTNIRRRSRHYRPRSRLPTVALHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 6, golg 3, nucl 2, cyto 2, extr 2, cyto_nucl 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018247  EF_Hand_1_Ca_BS  
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
Amino Acid Sequences MTQPNQPFSFKASLVSDSDYEDSDGSSVIPKTNIRRRSRHYRPRSRLPTVALIGCCAITGWFLSMASLYTFMLLSPEPDALQRNCVYDTLSTSWLPPYCRDAELTAKFDKSGDGPNGEWEYFADQNGTQRISVEEIAVLGDIGGHFWVSRYWHRAHCMFYWQKQFRQRDTKVVMEQRFDGLAHVEHCTRLLLRTTNLSALMPVPVLMNSSAADAIRLSPEENQDHSHHMRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.25
4 0.24
5 0.24
6 0.21
7 0.19
8 0.16
9 0.14
10 0.11
11 0.11
12 0.08
13 0.11
14 0.11
15 0.11
16 0.14
17 0.18
18 0.27
19 0.36
20 0.45
21 0.49
22 0.57
23 0.64
24 0.73
25 0.8
26 0.82
27 0.84
28 0.86
29 0.88
30 0.9
31 0.91
32 0.86
33 0.8
34 0.73
35 0.69
36 0.61
37 0.56
38 0.45
39 0.37
40 0.3
41 0.25
42 0.2
43 0.13
44 0.09
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.06
55 0.05
56 0.05
57 0.06
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.12
67 0.12
68 0.16
69 0.16
70 0.16
71 0.17
72 0.17
73 0.17
74 0.13
75 0.16
76 0.15
77 0.16
78 0.15
79 0.14
80 0.17
81 0.18
82 0.18
83 0.16
84 0.18
85 0.18
86 0.18
87 0.19
88 0.18
89 0.24
90 0.25
91 0.28
92 0.25
93 0.23
94 0.22
95 0.21
96 0.2
97 0.14
98 0.15
99 0.13
100 0.13
101 0.13
102 0.16
103 0.17
104 0.16
105 0.15
106 0.11
107 0.13
108 0.11
109 0.11
110 0.09
111 0.08
112 0.1
113 0.12
114 0.13
115 0.09
116 0.09
117 0.1
118 0.11
119 0.11
120 0.09
121 0.07
122 0.07
123 0.07
124 0.06
125 0.05
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.05
135 0.08
136 0.12
137 0.16
138 0.2
139 0.23
140 0.28
141 0.3
142 0.33
143 0.31
144 0.38
145 0.38
146 0.41
147 0.48
148 0.48
149 0.52
150 0.57
151 0.62
152 0.61
153 0.66
154 0.63
155 0.61
156 0.62
157 0.62
158 0.61
159 0.63
160 0.57
161 0.49
162 0.47
163 0.39
164 0.35
165 0.29
166 0.22
167 0.15
168 0.14
169 0.13
170 0.14
171 0.13
172 0.13
173 0.13
174 0.14
175 0.13
176 0.13
177 0.16
178 0.17
179 0.18
180 0.24
181 0.25
182 0.25
183 0.26
184 0.23
185 0.2
186 0.18
187 0.16
188 0.11
189 0.1
190 0.08
191 0.08
192 0.09
193 0.08
194 0.09
195 0.08
196 0.09
197 0.1
198 0.09
199 0.1
200 0.09
201 0.1
202 0.11
203 0.12
204 0.12
205 0.15
206 0.21
207 0.24
208 0.26
209 0.3
210 0.3
211 0.37