Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2AAY0

Protein Details
Accession B2AAY0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
175-194PPFPEAKRVSWKKRGRRTLWHydrophilic
NLS Segment(s)
PositionSequence
185-190WKKRGR
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR008901  ACER  
Gene Ontology GO:0016020  C:membrane  
GO:0016811  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides  
GO:0006672  P:ceramide metabolic process  
KEGG pan:PODANSg09809  -  
Pfam View protein in Pfam  
PF05875  Ceramidase  
Amino Acid Sequences MGHHNRHFAGDPHALEGVWSPPTMRISFCEEDYAVSRYFAEFISTLTNLAYVYYALVYMYGPGSKGLFSPRYDFMSISLLVLGIGSFAFHATLRQSMQFADELAMLGLVWSLLQGVLATGTKRDRILNWSMAVGFPLFSAFYISNGKIIYHASAFGLALVLITIRGHYLFLWRNPPFPEAKRVSWKKRGRRTLWLLLIGYALWNIDLEFCTELRSLRVKMGLPWAWVLELHGWWHVLTAVSASWFMDIVREVQEELRDGASLAGKDSESERLKEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.24
4 0.19
5 0.14
6 0.13
7 0.11
8 0.14
9 0.18
10 0.19
11 0.19
12 0.19
13 0.26
14 0.29
15 0.29
16 0.29
17 0.25
18 0.26
19 0.28
20 0.28
21 0.2
22 0.18
23 0.18
24 0.15
25 0.16
26 0.13
27 0.13
28 0.1
29 0.1
30 0.14
31 0.14
32 0.13
33 0.12
34 0.13
35 0.1
36 0.1
37 0.09
38 0.05
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.07
52 0.09
53 0.13
54 0.17
55 0.18
56 0.22
57 0.24
58 0.27
59 0.28
60 0.27
61 0.23
62 0.23
63 0.21
64 0.17
65 0.14
66 0.1
67 0.09
68 0.09
69 0.07
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.05
78 0.06
79 0.08
80 0.09
81 0.1
82 0.1
83 0.1
84 0.11
85 0.11
86 0.1
87 0.09
88 0.08
89 0.07
90 0.07
91 0.06
92 0.05
93 0.04
94 0.04
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.03
104 0.04
105 0.04
106 0.06
107 0.07
108 0.08
109 0.1
110 0.11
111 0.11
112 0.15
113 0.2
114 0.21
115 0.21
116 0.2
117 0.19
118 0.18
119 0.17
120 0.12
121 0.08
122 0.05
123 0.04
124 0.04
125 0.04
126 0.05
127 0.05
128 0.07
129 0.09
130 0.09
131 0.1
132 0.1
133 0.11
134 0.1
135 0.1
136 0.09
137 0.07
138 0.08
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.04
145 0.03
146 0.03
147 0.03
148 0.02
149 0.02
150 0.03
151 0.03
152 0.03
153 0.04
154 0.04
155 0.09
156 0.12
157 0.15
158 0.23
159 0.24
160 0.27
161 0.28
162 0.3
163 0.3
164 0.29
165 0.36
166 0.32
167 0.37
168 0.45
169 0.52
170 0.58
171 0.63
172 0.7
173 0.71
174 0.77
175 0.83
176 0.77
177 0.79
178 0.79
179 0.78
180 0.74
181 0.68
182 0.57
183 0.47
184 0.42
185 0.31
186 0.23
187 0.14
188 0.09
189 0.05
190 0.04
191 0.04
192 0.05
193 0.05
194 0.06
195 0.07
196 0.07
197 0.1
198 0.1
199 0.11
200 0.13
201 0.17
202 0.17
203 0.18
204 0.22
205 0.21
206 0.23
207 0.31
208 0.3
209 0.27
210 0.27
211 0.25
212 0.22
213 0.21
214 0.2
215 0.14
216 0.12
217 0.12
218 0.12
219 0.12
220 0.11
221 0.12
222 0.11
223 0.09
224 0.08
225 0.08
226 0.07
227 0.08
228 0.08
229 0.08
230 0.07
231 0.07
232 0.07
233 0.08
234 0.08
235 0.09
236 0.11
237 0.12
238 0.13
239 0.15
240 0.17
241 0.17
242 0.18
243 0.17
244 0.14
245 0.13
246 0.14
247 0.16
248 0.14
249 0.14
250 0.14
251 0.13
252 0.15
253 0.16
254 0.23
255 0.23