Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0I8I5

Protein Details
Accession R0I8I5    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGLRQVKTKHKRDKAPHEYLEBasic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 6.5, cyto_nucl 6, nucl 4.5
Family & Domain DBs
Amino Acid Sequences MGLRQVKTKHKRDKAPHEYLELWEKLCAQKFHEVVDDAVSLPPGGACMKIEVGSGEAGSTLGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.8
4 0.74
5 0.66
6 0.59
7 0.54
8 0.44
9 0.34
10 0.25
11 0.23
12 0.21
13 0.23
14 0.21
15 0.17
16 0.23
17 0.23
18 0.23
19 0.24
20 0.22
21 0.18
22 0.18
23 0.16
24 0.11
25 0.1
26 0.09
27 0.07
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.07
35 0.08
36 0.08
37 0.09
38 0.08
39 0.09
40 0.09
41 0.09
42 0.07
43 0.07
44 0.06