Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0ICT9

Protein Details
Accession R0ICT9    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
128-153KEKADKSTKPSEKKSRPKSPPTLKAAHydrophilic
NLS Segment(s)
PositionSequence
59-63VKSKK
96-185KPTPSTPSKAAASKASKPTKAASTVSKTDRSSKEKADKSTKPSEKKSRPKSPPTLKAAAPPKKAPEPKIVAKKKTESKPAPEPKKSRPRL
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MFPSVKDRARQLFGETAIPATTPPPPVATGRRGASNNAAATSKPAPEPKTPLKSSRADVKSKKEAPPPVEEPPRAIGAWPSPFEQFKARAAPPVAKPTPSTPSKAAASKASKPTKAASTVSKTDRSSKEKADKSTKPSEKKSRPKSPPTLKAAAPPKKAPEPKIVAKKKTESKPAPEPKKSRPRLQTRISSRSKVQHSSSSSSLDSDSESDSDESDEEEDLREACLREVHKVTALKGKSLAISLRQRSSGGWYAALKDVGADKYLKMWMNRDKTFATQDEALEAYLVFVKKMSNDMKLFGPMSPKPGRTKGFFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.34
3 0.28
4 0.24
5 0.22
6 0.18
7 0.14
8 0.15
9 0.14
10 0.15
11 0.15
12 0.17
13 0.23
14 0.28
15 0.32
16 0.34
17 0.35
18 0.4
19 0.4
20 0.41
21 0.41
22 0.41
23 0.37
24 0.33
25 0.31
26 0.25
27 0.28
28 0.28
29 0.24
30 0.22
31 0.26
32 0.29
33 0.33
34 0.41
35 0.46
36 0.53
37 0.55
38 0.57
39 0.58
40 0.58
41 0.58
42 0.6
43 0.57
44 0.57
45 0.6
46 0.62
47 0.66
48 0.68
49 0.7
50 0.67
51 0.68
52 0.63
53 0.64
54 0.6
55 0.59
56 0.6
57 0.54
58 0.49
59 0.44
60 0.42
61 0.34
62 0.29
63 0.23
64 0.2
65 0.24
66 0.22
67 0.22
68 0.22
69 0.22
70 0.24
71 0.26
72 0.23
73 0.23
74 0.28
75 0.27
76 0.29
77 0.31
78 0.35
79 0.34
80 0.41
81 0.39
82 0.33
83 0.35
84 0.33
85 0.38
86 0.35
87 0.35
88 0.28
89 0.31
90 0.33
91 0.34
92 0.32
93 0.32
94 0.35
95 0.38
96 0.45
97 0.46
98 0.44
99 0.43
100 0.44
101 0.4
102 0.39
103 0.35
104 0.31
105 0.31
106 0.36
107 0.38
108 0.4
109 0.37
110 0.41
111 0.45
112 0.45
113 0.44
114 0.46
115 0.52
116 0.52
117 0.58
118 0.59
119 0.57
120 0.58
121 0.65
122 0.65
123 0.62
124 0.66
125 0.7
126 0.71
127 0.77
128 0.8
129 0.8
130 0.81
131 0.83
132 0.85
133 0.83
134 0.82
135 0.78
136 0.72
137 0.61
138 0.6
139 0.61
140 0.58
141 0.51
142 0.44
143 0.41
144 0.44
145 0.47
146 0.43
147 0.41
148 0.4
149 0.44
150 0.53
151 0.56
152 0.53
153 0.54
154 0.58
155 0.58
156 0.58
157 0.61
158 0.54
159 0.54
160 0.61
161 0.67
162 0.69
163 0.69
164 0.68
165 0.68
166 0.75
167 0.74
168 0.72
169 0.72
170 0.73
171 0.74
172 0.76
173 0.75
174 0.73
175 0.77
176 0.73
177 0.66
178 0.6
179 0.59
180 0.57
181 0.52
182 0.46
183 0.44
184 0.43
185 0.44
186 0.42
187 0.37
188 0.33
189 0.29
190 0.26
191 0.19
192 0.16
193 0.12
194 0.12
195 0.09
196 0.1
197 0.09
198 0.09
199 0.09
200 0.09
201 0.08
202 0.08
203 0.08
204 0.07
205 0.07
206 0.07
207 0.07
208 0.08
209 0.09
210 0.08
211 0.09
212 0.13
213 0.13
214 0.17
215 0.2
216 0.2
217 0.24
218 0.25
219 0.27
220 0.31
221 0.31
222 0.27
223 0.27
224 0.27
225 0.22
226 0.22
227 0.22
228 0.21
229 0.29
230 0.32
231 0.33
232 0.33
233 0.33
234 0.32
235 0.37
236 0.35
237 0.28
238 0.27
239 0.25
240 0.26
241 0.28
242 0.28
243 0.21
244 0.15
245 0.17
246 0.15
247 0.16
248 0.14
249 0.12
250 0.14
251 0.19
252 0.22
253 0.2
254 0.27
255 0.35
256 0.43
257 0.45
258 0.46
259 0.44
260 0.44
261 0.48
262 0.43
263 0.38
264 0.32
265 0.3
266 0.28
267 0.27
268 0.22
269 0.17
270 0.15
271 0.11
272 0.12
273 0.12
274 0.1
275 0.1
276 0.11
277 0.12
278 0.19
279 0.22
280 0.26
281 0.27
282 0.3
283 0.32
284 0.35
285 0.35
286 0.3
287 0.33
288 0.27
289 0.34
290 0.38
291 0.41
292 0.43
293 0.51
294 0.55