Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KPQ0

Protein Details
Accession R0KPQ0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
107-128TDHYCKKNTKCSDKCACCKKGRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, golg 2, mito 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MLVAVALVGLLVLVNASPTVTDRKAVTGEQPSMSTQSVNQNNEENTYHCDDDPSAIACPAMDDCSAQGPLAIAKRDTPDTQAQENKRYECSKDHTGVLICRYGFCSTDHYCKKNTKCSDKCACCKKGRDILRDIGVFKDSSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.05
6 0.11
7 0.12
8 0.14
9 0.15
10 0.18
11 0.2
12 0.21
13 0.25
14 0.25
15 0.27
16 0.26
17 0.27
18 0.25
19 0.26
20 0.25
21 0.2
22 0.16
23 0.23
24 0.28
25 0.28
26 0.29
27 0.3
28 0.3
29 0.33
30 0.31
31 0.24
32 0.21
33 0.23
34 0.22
35 0.19
36 0.19
37 0.16
38 0.16
39 0.16
40 0.14
41 0.1
42 0.09
43 0.09
44 0.08
45 0.08
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.07
52 0.08
53 0.07
54 0.06
55 0.05
56 0.07
57 0.09
58 0.09
59 0.08
60 0.09
61 0.1
62 0.13
63 0.13
64 0.15
65 0.19
66 0.21
67 0.26
68 0.31
69 0.32
70 0.38
71 0.4
72 0.38
73 0.37
74 0.36
75 0.34
76 0.33
77 0.37
78 0.35
79 0.35
80 0.34
81 0.32
82 0.32
83 0.32
84 0.29
85 0.26
86 0.2
87 0.18
88 0.19
89 0.17
90 0.16
91 0.15
92 0.19
93 0.2
94 0.3
95 0.36
96 0.37
97 0.41
98 0.49
99 0.54
100 0.58
101 0.64
102 0.65
103 0.65
104 0.72
105 0.78
106 0.78
107 0.82
108 0.82
109 0.81
110 0.78
111 0.79
112 0.79
113 0.77
114 0.77
115 0.75
116 0.71
117 0.7
118 0.69
119 0.64
120 0.56
121 0.49
122 0.42