Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0K8Q4

Protein Details
Accession R0K8Q4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
37-56TQSSILQKLKKKPQECKICYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.833, mito_nucl 11.833
Family & Domain DBs
Amino Acid Sequences MNQRHLSDEKQHQHYYHQYQYQYQQQEQVQEQQEQNTQSSILQKLKKKPQECKICY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.57
3 0.54
4 0.51
5 0.45
6 0.45
7 0.49
8 0.51
9 0.46
10 0.39
11 0.37
12 0.33
13 0.35
14 0.33
15 0.34
16 0.29
17 0.28
18 0.28
19 0.25
20 0.27
21 0.25
22 0.24
23 0.18
24 0.16
25 0.14
26 0.18
27 0.2
28 0.24
29 0.29
30 0.36
31 0.45
32 0.55
33 0.63
34 0.68
35 0.73
36 0.77