Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0K3L3

Protein Details
Accession R0K3L3   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AYRYKEYMTKYPRRRKESRNPYYDKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSELPPLRKDPYALAYRYKEYMTKYPRRRKESRNPYYDKLLANLPDPAEDAMDNRSRAIRYAKKHYECYYEIRDIRRIVAWLPPVEEESSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.41
4 0.41
5 0.38
6 0.34
7 0.32
8 0.39
9 0.41
10 0.48
11 0.56
12 0.64
13 0.72
14 0.78
15 0.81
16 0.82
17 0.84
18 0.85
19 0.84
20 0.84
21 0.8
22 0.75
23 0.73
24 0.66
25 0.55
26 0.45
27 0.38
28 0.29
29 0.23
30 0.21
31 0.15
32 0.12
33 0.12
34 0.1
35 0.08
36 0.07
37 0.07
38 0.09
39 0.12
40 0.12
41 0.12
42 0.13
43 0.13
44 0.16
45 0.23
46 0.27
47 0.3
48 0.41
49 0.5
50 0.53
51 0.59
52 0.6
53 0.59
54 0.54
55 0.55
56 0.51
57 0.49
58 0.47
59 0.45
60 0.47
61 0.42
62 0.41
63 0.37
64 0.32
65 0.25
66 0.27
67 0.29
68 0.25
69 0.26
70 0.25
71 0.25