Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KEQ6

Protein Details
Accession R0KEQ6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
32-56TSAKGSQKPNRTHKHHHHKEPTPILBasic
NLS Segment(s)
Subcellular Location(s) extr 18, cyto_mito 4, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHFPSLVTALLFTTAALATPYPWAQPQSGVLTSAKGSQKPNRTHKHHHHKEPTPILKQACKCNMPVIPNNLLNANEKCLMKYAAQMGCYMSSKGGCPSPPAACGIGPLSGIPMM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.06
6 0.09
7 0.1
8 0.1
9 0.12
10 0.13
11 0.13
12 0.15
13 0.17
14 0.19
15 0.19
16 0.2
17 0.18
18 0.17
19 0.17
20 0.22
21 0.21
22 0.2
23 0.25
24 0.3
25 0.39
26 0.47
27 0.56
28 0.6
29 0.65
30 0.72
31 0.78
32 0.82
33 0.83
34 0.84
35 0.83
36 0.8
37 0.81
38 0.8
39 0.75
40 0.67
41 0.61
42 0.53
43 0.49
44 0.46
45 0.44
46 0.39
47 0.34
48 0.32
49 0.31
50 0.32
51 0.31
52 0.32
53 0.31
54 0.3
55 0.3
56 0.3
57 0.27
58 0.26
59 0.25
60 0.22
61 0.2
62 0.19
63 0.18
64 0.18
65 0.19
66 0.2
67 0.16
68 0.19
69 0.22
70 0.21
71 0.21
72 0.21
73 0.2
74 0.21
75 0.22
76 0.19
77 0.14
78 0.13
79 0.13
80 0.16
81 0.18
82 0.16
83 0.18
84 0.22
85 0.23
86 0.24
87 0.25
88 0.24
89 0.2
90 0.22
91 0.2
92 0.16
93 0.14
94 0.13