Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0JUT6

Protein Details
Accession R0JUT6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
88-116TKNKPATPKKAVTPRKRKNKNVDDDEVRAHydrophilic
NLS Segment(s)
PositionSequence
91-126KPATPKKAVTPRKRKNKNVDDDEVRATPRKRSRKNK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
Amino Acid Sequences MSDNEGAKAGKGWTDRQRLAYYFNLVEFSNAKLDFTNAPRPEGKSVGACRIMVDRLKGTLKSELAALRGGNGSSEDGGSATTTTTTTTKNKPATPKKAVTPRKRKNKNVDDDEVRATPRKRSRKNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.46
4 0.5
5 0.47
6 0.49
7 0.45
8 0.4
9 0.32
10 0.3
11 0.27
12 0.22
13 0.22
14 0.19
15 0.16
16 0.16
17 0.15
18 0.15
19 0.13
20 0.15
21 0.17
22 0.21
23 0.28
24 0.25
25 0.28
26 0.3
27 0.32
28 0.33
29 0.31
30 0.28
31 0.24
32 0.26
33 0.28
34 0.27
35 0.24
36 0.22
37 0.22
38 0.23
39 0.18
40 0.17
41 0.13
42 0.14
43 0.16
44 0.15
45 0.15
46 0.16
47 0.15
48 0.14
49 0.15
50 0.13
51 0.12
52 0.13
53 0.11
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.06
71 0.07
72 0.11
73 0.15
74 0.19
75 0.27
76 0.32
77 0.36
78 0.46
79 0.55
80 0.61
81 0.64
82 0.65
83 0.66
84 0.72
85 0.77
86 0.78
87 0.79
88 0.8
89 0.83
90 0.89
91 0.9
92 0.91
93 0.91
94 0.91
95 0.88
96 0.87
97 0.82
98 0.75
99 0.7
100 0.61
101 0.53
102 0.49
103 0.42
104 0.43
105 0.47
106 0.54