Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KGK4

Protein Details
Accession R0KGK4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-126LEKDAEEKRRLRNEKRRAKKKADSNAMEWBasic
NLS Segment(s)
PositionSequence
104-118EKRRLRNEKRRAKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040107  Snu23  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0046872  F:metal ion binding  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
Amino Acid Sequences MIGKQTLTSAAAAVGKRGRGAGAYCAACDLTFKDNIQYIEHLNSRQHLIATGQSGEVRRATLQEVRDRLRYLKRKREEDKALEVTDLDARLAMNKEQLEKDAEEKRRLRNEKRRAKKKADSNAMEWKVEGDGVIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.18
5 0.16
6 0.14
7 0.16
8 0.17
9 0.21
10 0.2
11 0.2
12 0.2
13 0.2
14 0.18
15 0.17
16 0.15
17 0.11
18 0.13
19 0.14
20 0.15
21 0.19
22 0.2
23 0.21
24 0.2
25 0.19
26 0.21
27 0.23
28 0.22
29 0.19
30 0.2
31 0.2
32 0.19
33 0.17
34 0.13
35 0.13
36 0.13
37 0.13
38 0.12
39 0.11
40 0.12
41 0.12
42 0.12
43 0.11
44 0.1
45 0.09
46 0.09
47 0.11
48 0.13
49 0.16
50 0.2
51 0.23
52 0.25
53 0.27
54 0.27
55 0.28
56 0.34
57 0.41
58 0.44
59 0.5
60 0.56
61 0.63
62 0.66
63 0.72
64 0.71
65 0.67
66 0.66
67 0.6
68 0.53
69 0.44
70 0.39
71 0.31
72 0.24
73 0.19
74 0.11
75 0.07
76 0.06
77 0.08
78 0.1
79 0.09
80 0.11
81 0.12
82 0.15
83 0.16
84 0.17
85 0.18
86 0.18
87 0.23
88 0.28
89 0.33
90 0.38
91 0.42
92 0.49
93 0.56
94 0.64
95 0.69
96 0.71
97 0.77
98 0.8
99 0.87
100 0.9
101 0.89
102 0.9
103 0.89
104 0.88
105 0.88
106 0.88
107 0.82
108 0.77
109 0.79
110 0.72
111 0.63
112 0.53
113 0.43
114 0.33
115 0.27