Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0IRV0

Protein Details
Accession R0IRV0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-111AENCNGGKKNKRGRLAFRNSLRNHydrophilic
NLS Segment(s)
PositionSequence
98-100NKR
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MSYHMCCDIFNNPNTFLPTGLHPAGQNKPFPGSGFPSGGFPNGGFPNGGFPNGGFPSGGFPNGGFPNGGFPSGGFPKPSTAGAGAAHSAENCNGGKKNKRGRLAFRNSLRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.28
4 0.23
5 0.22
6 0.24
7 0.22
8 0.21
9 0.19
10 0.23
11 0.29
12 0.31
13 0.3
14 0.25
15 0.27
16 0.27
17 0.27
18 0.25
19 0.23
20 0.23
21 0.23
22 0.22
23 0.21
24 0.21
25 0.2
26 0.18
27 0.12
28 0.13
29 0.12
30 0.12
31 0.1
32 0.09
33 0.13
34 0.13
35 0.13
36 0.09
37 0.09
38 0.12
39 0.12
40 0.13
41 0.08
42 0.08
43 0.1
44 0.1
45 0.11
46 0.07
47 0.07
48 0.1
49 0.11
50 0.11
51 0.09
52 0.08
53 0.12
54 0.12
55 0.12
56 0.08
57 0.08
58 0.12
59 0.15
60 0.16
61 0.13
62 0.14
63 0.16
64 0.17
65 0.18
66 0.15
67 0.13
68 0.14
69 0.13
70 0.14
71 0.12
72 0.11
73 0.11
74 0.1
75 0.1
76 0.09
77 0.11
78 0.1
79 0.13
80 0.18
81 0.25
82 0.34
83 0.43
84 0.53
85 0.59
86 0.67
87 0.72
88 0.77
89 0.81
90 0.82
91 0.83