Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0K2C7

Protein Details
Accession R0K2C7    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
231-264AEAKPAPKKGGRPKKEKKEPAKKREPKKAATADGBasic
NLS Segment(s)
PositionSequence
208-274AKKPAEKKAKTDEAAPEGEGKDEAEAKPAPKKGGRPKKEKKEPAKKREPKKAATADGTPRRSGRNKA
Subcellular Location(s) mito 12, nucl 8.5, cyto_nucl 6.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MTGTEIQQGDKVSWNWGSGQPSGTVAEVKDQGEIAIESNKGNTIKKNADPENPAVHVERSGNDVVKRASELQIDEKAEGANGDSKQEEKKEEAEKPDEKPVEAEVKGDEKPAESEKKDEEMKDAPAAEEKKEEEAQTNGDSKEESKDEPKESKESKESKEDDKDKVAEDKADEKPEADAKEDEPKAGDKRKADELPEKTNGADSHADAKKPAEKKAKTDEAAPEGEGKDEAEAKPAPKKGGRPKKEKKEPAKKREPKKAATADGTPRRSGRNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.27
4 0.29
5 0.26
6 0.26
7 0.23
8 0.23
9 0.23
10 0.21
11 0.18
12 0.14
13 0.17
14 0.18
15 0.18
16 0.17
17 0.16
18 0.15
19 0.15
20 0.15
21 0.12
22 0.12
23 0.12
24 0.12
25 0.13
26 0.16
27 0.17
28 0.19
29 0.22
30 0.26
31 0.31
32 0.36
33 0.45
34 0.46
35 0.5
36 0.52
37 0.52
38 0.5
39 0.46
40 0.42
41 0.35
42 0.31
43 0.27
44 0.23
45 0.2
46 0.19
47 0.19
48 0.2
49 0.19
50 0.22
51 0.2
52 0.2
53 0.21
54 0.19
55 0.2
56 0.19
57 0.2
58 0.21
59 0.26
60 0.26
61 0.24
62 0.22
63 0.19
64 0.17
65 0.15
66 0.12
67 0.12
68 0.11
69 0.12
70 0.12
71 0.13
72 0.16
73 0.19
74 0.2
75 0.17
76 0.23
77 0.27
78 0.31
79 0.35
80 0.39
81 0.4
82 0.4
83 0.46
84 0.41
85 0.35
86 0.32
87 0.29
88 0.28
89 0.24
90 0.22
91 0.16
92 0.18
93 0.18
94 0.18
95 0.15
96 0.11
97 0.13
98 0.16
99 0.2
100 0.18
101 0.2
102 0.21
103 0.25
104 0.26
105 0.25
106 0.24
107 0.21
108 0.22
109 0.21
110 0.19
111 0.15
112 0.18
113 0.18
114 0.15
115 0.15
116 0.14
117 0.16
118 0.17
119 0.17
120 0.14
121 0.13
122 0.15
123 0.15
124 0.17
125 0.14
126 0.13
127 0.13
128 0.12
129 0.14
130 0.13
131 0.13
132 0.14
133 0.18
134 0.21
135 0.24
136 0.26
137 0.3
138 0.31
139 0.34
140 0.38
141 0.4
142 0.39
143 0.44
144 0.45
145 0.44
146 0.51
147 0.51
148 0.46
149 0.45
150 0.42
151 0.36
152 0.37
153 0.31
154 0.23
155 0.21
156 0.24
157 0.24
158 0.26
159 0.24
160 0.2
161 0.22
162 0.24
163 0.23
164 0.2
165 0.18
166 0.16
167 0.25
168 0.25
169 0.23
170 0.2
171 0.23
172 0.26
173 0.32
174 0.35
175 0.29
176 0.33
177 0.4
178 0.42
179 0.43
180 0.47
181 0.46
182 0.48
183 0.49
184 0.45
185 0.37
186 0.38
187 0.34
188 0.28
189 0.24
190 0.19
191 0.24
192 0.26
193 0.26
194 0.23
195 0.26
196 0.29
197 0.3
198 0.38
199 0.39
200 0.4
201 0.46
202 0.55
203 0.61
204 0.55
205 0.58
206 0.55
207 0.49
208 0.48
209 0.42
210 0.35
211 0.27
212 0.26
213 0.21
214 0.16
215 0.13
216 0.14
217 0.14
218 0.15
219 0.17
220 0.18
221 0.25
222 0.28
223 0.32
224 0.33
225 0.43
226 0.5
227 0.59
228 0.66
229 0.71
230 0.79
231 0.85
232 0.91
233 0.93
234 0.93
235 0.93
236 0.95
237 0.95
238 0.95
239 0.93
240 0.93
241 0.93
242 0.91
243 0.86
244 0.85
245 0.83
246 0.79
247 0.75
248 0.72
249 0.71
250 0.72
251 0.69
252 0.62
253 0.56
254 0.56