Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0IY82

Protein Details
Accession R0IY82   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
112-133TPAPRKRKSSAPKKASSKEKDSHydrophilic
NLS Segment(s)
PositionSequence
87-98RSRNKATPRAKK
113-129PAPRKRKSSAPKKASSK
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 10.5
Family & Domain DBs
Amino Acid Sequences MPKWTPELDAIVLRGVFEECNVSFGKELCAKISQRVVDIGIECTPKAVENRLYSWKKKNTAGGATNPTSSATGTPAKPASATQKTPRSRNKATPRAKKEEDGDDGEEPLSPTPAPRKRKSSAPKKASSKEKDSGDDDIEEDDFPKSKKVKAEPSEEGPSGGEDVTDEDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.13
3 0.11
4 0.09
5 0.12
6 0.1
7 0.12
8 0.13
9 0.13
10 0.13
11 0.14
12 0.19
13 0.2
14 0.2
15 0.2
16 0.26
17 0.26
18 0.3
19 0.34
20 0.3
21 0.27
22 0.27
23 0.26
24 0.22
25 0.22
26 0.19
27 0.16
28 0.16
29 0.15
30 0.14
31 0.13
32 0.13
33 0.13
34 0.16
35 0.19
36 0.2
37 0.25
38 0.34
39 0.39
40 0.43
41 0.5
42 0.53
43 0.53
44 0.54
45 0.56
46 0.52
47 0.53
48 0.52
49 0.49
50 0.47
51 0.43
52 0.4
53 0.34
54 0.29
55 0.22
56 0.18
57 0.13
58 0.1
59 0.12
60 0.12
61 0.14
62 0.14
63 0.14
64 0.14
65 0.15
66 0.19
67 0.21
68 0.24
69 0.28
70 0.36
71 0.4
72 0.47
73 0.54
74 0.55
75 0.55
76 0.62
77 0.66
78 0.68
79 0.74
80 0.77
81 0.77
82 0.77
83 0.74
84 0.68
85 0.61
86 0.56
87 0.5
88 0.42
89 0.38
90 0.29
91 0.27
92 0.24
93 0.21
94 0.15
95 0.12
96 0.09
97 0.06
98 0.07
99 0.16
100 0.24
101 0.32
102 0.38
103 0.45
104 0.47
105 0.58
106 0.67
107 0.69
108 0.72
109 0.73
110 0.76
111 0.78
112 0.83
113 0.83
114 0.8
115 0.76
116 0.72
117 0.67
118 0.63
119 0.57
120 0.52
121 0.44
122 0.37
123 0.3
124 0.24
125 0.21
126 0.16
127 0.14
128 0.12
129 0.12
130 0.12
131 0.18
132 0.18
133 0.22
134 0.3
135 0.37
136 0.47
137 0.52
138 0.59
139 0.59
140 0.64
141 0.67
142 0.59
143 0.52
144 0.42
145 0.36
146 0.29
147 0.22
148 0.15
149 0.09