Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0D3F4

Protein Details
Accession B0D3F4   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
53-84ELVTQAGKKRKRREREKEKKAKKRRLAESAAPBasic
NLS Segment(s)
PositionSequence
59-77GKKRKRREREKEKKAKKRR
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
KEGG lbc:LACBIDRAFT_324905  -  
Amino Acid Sequences MKLEGGDDLEDDFVPDDLVALSEDEGEGAPIQDNGEFVAGEGSEDEEVQDSTELVTQAGKKRKRREREKEKKAKKRRLAESAAPVDLPLAVKAPEELAQYMSSMQRGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.05
5 0.06
6 0.06
7 0.06
8 0.06
9 0.05
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.05
37 0.04
38 0.04
39 0.06
40 0.06
41 0.05
42 0.06
43 0.08
44 0.15
45 0.23
46 0.3
47 0.36
48 0.46
49 0.56
50 0.65
51 0.74
52 0.79
53 0.83
54 0.88
55 0.92
56 0.93
57 0.95
58 0.95
59 0.95
60 0.94
61 0.92
62 0.91
63 0.88
64 0.86
65 0.82
66 0.78
67 0.76
68 0.69
69 0.6
70 0.5
71 0.41
72 0.32
73 0.25
74 0.19
75 0.1
76 0.08
77 0.07
78 0.08
79 0.08
80 0.1
81 0.12
82 0.13
83 0.13
84 0.14
85 0.14
86 0.14
87 0.16
88 0.16