Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KV95

Protein Details
Accession R0KV95    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-21APRAQHKHHSTARPGRHRDYBasic
193-216AIMANKPWPRERKKAGAEKPVLKMHydrophilic
NLS Segment(s)
PositionSequence
168-221KPLLAKRAKKPTSIIKRAFTNEKLRAIMANKPWPRERKKAGAEKPVLKMGVRRE
Subcellular Location(s) nucl 22, mito_nucl 13.833, cyto_nucl 11.833
Family & Domain DBs
Amino Acid Sequences MAPRAQHKHHSTARPGRHRDYLNARNGAGVAANRSSALASASSAAATAAALKKLDERERGGGAERSMGMHVDAMVHDGYDYGNASEKSKNEGKDKGKGNASPRYASSSSSSPFFPTTTTASNIFSNNHNNNNKDEDANKDKDADADDDEEEDEHVPNNKRSIMVVPPKPLLAKRAKKPTSIIKRAFTNEKLRAIMANKPWPRERKKAGAEKPVLKMGVRREYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.77
4 0.76
5 0.71
6 0.7
7 0.7
8 0.68
9 0.67
10 0.63
11 0.57
12 0.49
13 0.46
14 0.38
15 0.29
16 0.21
17 0.15
18 0.13
19 0.13
20 0.12
21 0.12
22 0.12
23 0.1
24 0.1
25 0.07
26 0.07
27 0.08
28 0.08
29 0.07
30 0.07
31 0.07
32 0.06
33 0.05
34 0.08
35 0.08
36 0.09
37 0.09
38 0.1
39 0.14
40 0.19
41 0.25
42 0.26
43 0.28
44 0.3
45 0.32
46 0.33
47 0.32
48 0.29
49 0.24
50 0.22
51 0.18
52 0.16
53 0.14
54 0.13
55 0.1
56 0.08
57 0.08
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.04
69 0.08
70 0.08
71 0.1
72 0.13
73 0.14
74 0.18
75 0.22
76 0.26
77 0.27
78 0.35
79 0.37
80 0.42
81 0.45
82 0.45
83 0.45
84 0.45
85 0.46
86 0.45
87 0.44
88 0.37
89 0.34
90 0.35
91 0.31
92 0.29
93 0.26
94 0.21
95 0.2
96 0.2
97 0.19
98 0.14
99 0.15
100 0.13
101 0.12
102 0.11
103 0.13
104 0.13
105 0.15
106 0.15
107 0.16
108 0.17
109 0.17
110 0.16
111 0.16
112 0.22
113 0.23
114 0.3
115 0.32
116 0.33
117 0.34
118 0.37
119 0.35
120 0.3
121 0.28
122 0.27
123 0.29
124 0.31
125 0.29
126 0.26
127 0.25
128 0.25
129 0.26
130 0.21
131 0.15
132 0.14
133 0.13
134 0.13
135 0.13
136 0.12
137 0.1
138 0.09
139 0.08
140 0.07
141 0.13
142 0.15
143 0.17
144 0.19
145 0.2
146 0.19
147 0.2
148 0.23
149 0.26
150 0.32
151 0.35
152 0.36
153 0.36
154 0.37
155 0.38
156 0.36
157 0.35
158 0.36
159 0.41
160 0.46
161 0.56
162 0.58
163 0.59
164 0.64
165 0.67
166 0.68
167 0.69
168 0.66
169 0.6
170 0.63
171 0.65
172 0.67
173 0.62
174 0.61
175 0.57
176 0.55
177 0.51
178 0.45
179 0.44
180 0.4
181 0.4
182 0.39
183 0.43
184 0.42
185 0.47
186 0.54
187 0.6
188 0.65
189 0.68
190 0.69
191 0.69
192 0.76
193 0.8
194 0.81
195 0.82
196 0.83
197 0.8
198 0.77
199 0.72
200 0.63
201 0.53
202 0.5
203 0.48