Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0IXY1

Protein Details
Accession R0IXY1   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MHDQGPRTLKPPRRRRKKTPRPTTVPSRLVPBasic
NLS Segment(s)
PositionSequence
9-21LKPPRRRRKKTPR
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MHDQGPRTLKPPRRRRKKTPRPTTVPSRLVPTHPDPPALTSHDEPGPGGCCTRGFKRTSPALPAASALFASLLDPQPTYIQGKEHGASGTRGCSTRDGGKRRYRSDAACQLGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.9
3 0.92
4 0.94
5 0.95
6 0.95
7 0.94
8 0.91
9 0.9
10 0.89
11 0.87
12 0.81
13 0.71
14 0.67
15 0.58
16 0.51
17 0.49
18 0.43
19 0.41
20 0.36
21 0.36
22 0.3
23 0.3
24 0.31
25 0.28
26 0.26
27 0.19
28 0.21
29 0.2
30 0.2
31 0.18
32 0.16
33 0.15
34 0.12
35 0.11
36 0.09
37 0.09
38 0.12
39 0.16
40 0.19
41 0.2
42 0.22
43 0.28
44 0.32
45 0.32
46 0.34
47 0.33
48 0.29
49 0.26
50 0.25
51 0.2
52 0.14
53 0.13
54 0.09
55 0.06
56 0.05
57 0.05
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.11
65 0.13
66 0.11
67 0.12
68 0.14
69 0.18
70 0.17
71 0.18
72 0.17
73 0.17
74 0.18
75 0.18
76 0.18
77 0.17
78 0.18
79 0.18
80 0.19
81 0.22
82 0.29
83 0.37
84 0.41
85 0.48
86 0.57
87 0.65
88 0.67
89 0.72
90 0.69
91 0.66
92 0.69
93 0.69