Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B0CSY0

Protein Details
Accession B0CSY0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-63VTRGAGFRKEKNKKKRGSYRGGEITBasic
NLS Segment(s)
PositionSequence
45-55FRKEKNKKKRG
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
KEGG lbc:LACBIDRAFT_292357  -  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences MRVRPETVAMNNNFVDNRYEAKAGPSNDYGSRAHSDLIVTRGAGFRKEKNKKKRGSYRGGEITMESHSFKFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.18
4 0.19
5 0.17
6 0.18
7 0.17
8 0.21
9 0.25
10 0.24
11 0.26
12 0.24
13 0.24
14 0.24
15 0.27
16 0.23
17 0.2
18 0.2
19 0.17
20 0.16
21 0.13
22 0.13
23 0.11
24 0.13
25 0.1
26 0.08
27 0.08
28 0.1
29 0.11
30 0.13
31 0.15
32 0.2
33 0.31
34 0.41
35 0.51
36 0.59
37 0.69
38 0.74
39 0.82
40 0.87
41 0.86
42 0.86
43 0.82
44 0.81
45 0.8
46 0.73
47 0.63
48 0.53
49 0.44
50 0.37
51 0.33
52 0.24