Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KIF2

Protein Details
Accession R0KIF2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-79REAAKEKRDKIKKVWKELDEBasic
NLS Segment(s)
PositionSequence
59-73NREAAKEKRDKIKKV
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005509  F:calcium ion binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
PS50222  EF_HAND_2  
Amino Acid Sequences MHPHLHTEEVQKNCADVVAALEECHAHGFLWKVTGNCTDAKHKVNMCLRGIRLERTRQNREAAKEKRDKIKKVWKELDENK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.18
3 0.11
4 0.09
5 0.1
6 0.1
7 0.09
8 0.09
9 0.09
10 0.09
11 0.1
12 0.08
13 0.05
14 0.06
15 0.08
16 0.08
17 0.11
18 0.12
19 0.12
20 0.13
21 0.15
22 0.15
23 0.16
24 0.18
25 0.2
26 0.22
27 0.24
28 0.26
29 0.25
30 0.3
31 0.34
32 0.37
33 0.34
34 0.35
35 0.33
36 0.36
37 0.37
38 0.35
39 0.35
40 0.38
41 0.44
42 0.49
43 0.56
44 0.53
45 0.58
46 0.58
47 0.6
48 0.62
49 0.61
50 0.62
51 0.64
52 0.67
53 0.71
54 0.74
55 0.73
56 0.73
57 0.77
58 0.77
59 0.78
60 0.82
61 0.77