Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

O42825

Protein Details
Accession O42825    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
176-198EAATRASLRVKEKKEKKKKCVVLHydrophilic
NLS Segment(s)
PositionSequence
184-194RVKEKKEKKKK
Subcellular Location(s) cyto_nucl 11.666, nucl 11, cyto 9, mito_nucl 8.832, cyto_mito 7.832, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1903561  C:extracellular vesicle  
GO:0001411  C:hyphal tip  
GO:0005886  C:plasma membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0006075  P:(1->3)-beta-D-glucan biosynthetic process  
GO:1900240  P:negative regulation of phenotypic switching  
GO:0007266  P:Rho protein signal transduction  
GO:0007264  P:small GTPase mediated signal transduction  
KEGG cal:CAALFM_CR02860WA  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51420  RHO  
CDD cd01870  RhoA_like  
Amino Acid Sequences MVNGPAELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRKVELALWDTAGQEDYDRLRPLSYPDSNVILICFSVDSPDSLDNVLEKWISEVLHFCQGVPIILVGCKSDLRDDPHTIEALRQQQQQPVSTSEGQQVAQRIGAADYLECSAKTGRGVREVFEAATRASLRVKEKKEKKKKCVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.23
5 0.22
6 0.21
7 0.19
8 0.15
9 0.13
10 0.12
11 0.09
12 0.09
13 0.1
14 0.12
15 0.15
16 0.15
17 0.16
18 0.16
19 0.18
20 0.15
21 0.15
22 0.19
23 0.17
24 0.19
25 0.18
26 0.19
27 0.18
28 0.19
29 0.18
30 0.12
31 0.11
32 0.1
33 0.1
34 0.09
35 0.07
36 0.06
37 0.08
38 0.09
39 0.09
40 0.08
41 0.07
42 0.07
43 0.07
44 0.07
45 0.08
46 0.09
47 0.09
48 0.1
49 0.11
50 0.11
51 0.11
52 0.11
53 0.09
54 0.07
55 0.08
56 0.09
57 0.12
58 0.13
59 0.13
60 0.12
61 0.13
62 0.17
63 0.22
64 0.21
65 0.21
66 0.21
67 0.23
68 0.23
69 0.23
70 0.19
71 0.12
72 0.1
73 0.08
74 0.06
75 0.04
76 0.04
77 0.04
78 0.05
79 0.06
80 0.07
81 0.07
82 0.07
83 0.07
84 0.06
85 0.07
86 0.07
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.07
94 0.08
95 0.13
96 0.13
97 0.12
98 0.12
99 0.12
100 0.12
101 0.11
102 0.09
103 0.05
104 0.05
105 0.06
106 0.05
107 0.06
108 0.06
109 0.06
110 0.09
111 0.12
112 0.17
113 0.21
114 0.24
115 0.26
116 0.27
117 0.27
118 0.25
119 0.23
120 0.23
121 0.25
122 0.26
123 0.28
124 0.29
125 0.32
126 0.34
127 0.36
128 0.33
129 0.29
130 0.3
131 0.27
132 0.26
133 0.26
134 0.25
135 0.23
136 0.22
137 0.21
138 0.17
139 0.16
140 0.15
141 0.12
142 0.11
143 0.11
144 0.09
145 0.08
146 0.08
147 0.09
148 0.09
149 0.09
150 0.1
151 0.1
152 0.11
153 0.15
154 0.19
155 0.21
156 0.28
157 0.29
158 0.29
159 0.33
160 0.33
161 0.3
162 0.26
163 0.24
164 0.17
165 0.2
166 0.19
167 0.16
168 0.18
169 0.22
170 0.29
171 0.37
172 0.45
173 0.52
174 0.62
175 0.72
176 0.8
177 0.86
178 0.88