Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0J5H4

Protein Details
Accession R0J5H4   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
360-379VYPGEGRRPKRSRSKVAFGEHydrophilic
NLS Segment(s)
PositionSequence
367-371RPKRS
Subcellular Location(s) mito 9, nucl 8, cyto 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036887  HTH_APSES_sf  
IPR003163  Tscrpt_reg_HTH_APSES-type  
Gene Ontology GO:0003677  F:DNA binding  
PROSITE View protein in PROSITE  
PS51299  HTH_APSES  
Amino Acid Sequences MKIIQLLNPVCSDRHGPRNPEPPTPSSGPVTTAAAVPASRRHKIPKYAPIFSEGKKPVGIINFPPYEAGNDKELVAQHRRLQVYPSGDIAKKGVGHIPYNSDKKDFLEKTGRTAFEMFQYTYNVPGDEKEYVVVWDYNVGLVRMTPFFKSCKYSKTIPAKALRENAGLKDISYSITGGALVCQGYWMPYYAARAIAATFCYDIRWALTPVFGNDFPLLCLPPDDPGFGRFVIDPAIVKYCAEETTRFRELGPLYEVRRPVTPPLRVEAPKARSRQLQLNDPGAKQRRVRPIDTESGYGSDTDQSERCLYSPEVSPRTRFTPINRPLSPFSPYTTEHPLMSSPASMRAPPGLLTPTSAPYVYPGEGRRPKRSRSKVAFGEHPMNDTAARPPTAATIDSVHSPEMAGGRGGNRSHVDMDAAEMLMSLRTADNPMPPLKRARRGSTW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.44
3 0.49
4 0.56
5 0.66
6 0.68
7 0.7
8 0.69
9 0.62
10 0.62
11 0.59
12 0.53
13 0.47
14 0.44
15 0.38
16 0.34
17 0.33
18 0.26
19 0.22
20 0.19
21 0.16
22 0.16
23 0.15
24 0.21
25 0.25
26 0.27
27 0.31
28 0.4
29 0.47
30 0.56
31 0.64
32 0.66
33 0.68
34 0.71
35 0.68
36 0.65
37 0.61
38 0.53
39 0.54
40 0.46
41 0.41
42 0.35
43 0.34
44 0.32
45 0.32
46 0.33
47 0.28
48 0.33
49 0.32
50 0.31
51 0.32
52 0.28
53 0.27
54 0.26
55 0.24
56 0.18
57 0.18
58 0.18
59 0.2
60 0.22
61 0.24
62 0.27
63 0.29
64 0.32
65 0.38
66 0.4
67 0.38
68 0.39
69 0.4
70 0.39
71 0.36
72 0.34
73 0.32
74 0.31
75 0.31
76 0.28
77 0.25
78 0.2
79 0.2
80 0.21
81 0.19
82 0.21
83 0.22
84 0.27
85 0.33
86 0.37
87 0.38
88 0.35
89 0.33
90 0.33
91 0.42
92 0.36
93 0.35
94 0.4
95 0.38
96 0.43
97 0.49
98 0.46
99 0.38
100 0.39
101 0.33
102 0.28
103 0.31
104 0.25
105 0.2
106 0.23
107 0.21
108 0.22
109 0.22
110 0.17
111 0.14
112 0.14
113 0.15
114 0.13
115 0.13
116 0.11
117 0.11
118 0.11
119 0.12
120 0.12
121 0.09
122 0.09
123 0.09
124 0.09
125 0.09
126 0.09
127 0.07
128 0.07
129 0.09
130 0.09
131 0.1
132 0.1
133 0.12
134 0.14
135 0.16
136 0.21
137 0.22
138 0.25
139 0.29
140 0.33
141 0.41
142 0.49
143 0.52
144 0.54
145 0.6
146 0.59
147 0.58
148 0.58
149 0.51
150 0.44
151 0.4
152 0.34
153 0.29
154 0.25
155 0.2
156 0.17
157 0.15
158 0.12
159 0.11
160 0.1
161 0.07
162 0.07
163 0.07
164 0.06
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.04
171 0.05
172 0.05
173 0.06
174 0.06
175 0.06
176 0.08
177 0.09
178 0.1
179 0.09
180 0.09
181 0.08
182 0.08
183 0.08
184 0.07
185 0.07
186 0.06
187 0.06
188 0.06
189 0.06
190 0.07
191 0.08
192 0.09
193 0.08
194 0.1
195 0.1
196 0.1
197 0.13
198 0.12
199 0.12
200 0.11
201 0.11
202 0.1
203 0.1
204 0.1
205 0.07
206 0.07
207 0.06
208 0.08
209 0.08
210 0.09
211 0.08
212 0.09
213 0.1
214 0.1
215 0.1
216 0.08
217 0.08
218 0.08
219 0.08
220 0.08
221 0.07
222 0.09
223 0.08
224 0.08
225 0.08
226 0.08
227 0.09
228 0.11
229 0.12
230 0.14
231 0.21
232 0.23
233 0.22
234 0.22
235 0.25
236 0.24
237 0.24
238 0.24
239 0.21
240 0.21
241 0.25
242 0.26
243 0.22
244 0.24
245 0.22
246 0.25
247 0.28
248 0.3
249 0.28
250 0.31
251 0.36
252 0.35
253 0.38
254 0.39
255 0.38
256 0.4
257 0.41
258 0.41
259 0.4
260 0.42
261 0.46
262 0.42
263 0.45
264 0.43
265 0.48
266 0.48
267 0.44
268 0.49
269 0.46
270 0.47
271 0.42
272 0.46
273 0.48
274 0.5
275 0.52
276 0.5
277 0.51
278 0.53
279 0.51
280 0.45
281 0.36
282 0.32
283 0.3
284 0.24
285 0.18
286 0.13
287 0.11
288 0.12
289 0.12
290 0.13
291 0.14
292 0.14
293 0.14
294 0.15
295 0.15
296 0.16
297 0.22
298 0.27
299 0.32
300 0.34
301 0.36
302 0.35
303 0.39
304 0.4
305 0.37
306 0.36
307 0.4
308 0.47
309 0.54
310 0.53
311 0.53
312 0.52
313 0.52
314 0.49
315 0.39
316 0.33
317 0.28
318 0.28
319 0.28
320 0.33
321 0.31
322 0.28
323 0.28
324 0.26
325 0.24
326 0.22
327 0.2
328 0.13
329 0.17
330 0.18
331 0.17
332 0.17
333 0.17
334 0.17
335 0.16
336 0.17
337 0.15
338 0.14
339 0.16
340 0.16
341 0.17
342 0.17
343 0.17
344 0.14
345 0.15
346 0.18
347 0.16
348 0.19
349 0.19
350 0.28
351 0.37
352 0.43
353 0.51
354 0.54
355 0.62
356 0.69
357 0.77
358 0.77
359 0.78
360 0.82
361 0.8
362 0.8
363 0.79
364 0.74
365 0.72
366 0.62
367 0.55
368 0.46
369 0.38
370 0.32
371 0.26
372 0.24
373 0.2
374 0.21
375 0.18
376 0.18
377 0.2
378 0.22
379 0.21
380 0.18
381 0.16
382 0.17
383 0.19
384 0.2
385 0.17
386 0.15
387 0.15
388 0.14
389 0.13
390 0.12
391 0.11
392 0.11
393 0.13
394 0.18
395 0.18
396 0.21
397 0.21
398 0.23
399 0.24
400 0.24
401 0.23
402 0.18
403 0.2
404 0.18
405 0.16
406 0.13
407 0.11
408 0.11
409 0.09
410 0.09
411 0.07
412 0.06
413 0.07
414 0.11
415 0.13
416 0.17
417 0.21
418 0.29
419 0.31
420 0.34
421 0.44
422 0.49
423 0.58
424 0.61