Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0IB99

Protein Details
Accession R0IB99    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-46KIQNRIAQRHYRSKLKKRLEEAESHydrophilic
NLS Segment(s)
PositionSequence
61-81KQPRPRGRAKTAKTGQRRNRA
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MSGCASLQMDDWTKVSDPAERRKIQNRIAQRHYRSKLKKRLEEAESIIASESHSVSDGQPKQPRPRGRAKTAKTGQRRNRATGPQGRSIAPAPAPQQQQERKEECSTALPPAVHSLLPISGGAGGHPAQDTSSSLPTFYASTTMPVSSATPLSECLAPNVCYNNDDSPFNEGYLAMNGYWLPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.23
4 0.27
5 0.36
6 0.44
7 0.46
8 0.52
9 0.59
10 0.67
11 0.68
12 0.69
13 0.7
14 0.7
15 0.74
16 0.78
17 0.76
18 0.78
19 0.77
20 0.79
21 0.79
22 0.8
23 0.81
24 0.82
25 0.82
26 0.79
27 0.81
28 0.75
29 0.7
30 0.63
31 0.58
32 0.48
33 0.4
34 0.33
35 0.24
36 0.2
37 0.16
38 0.12
39 0.06
40 0.07
41 0.07
42 0.08
43 0.16
44 0.2
45 0.26
46 0.32
47 0.37
48 0.45
49 0.53
50 0.59
51 0.57
52 0.64
53 0.65
54 0.69
55 0.74
56 0.69
57 0.72
58 0.71
59 0.74
60 0.72
61 0.74
62 0.73
63 0.74
64 0.73
65 0.67
66 0.67
67 0.62
68 0.61
69 0.59
70 0.55
71 0.5
72 0.48
73 0.44
74 0.39
75 0.35
76 0.29
77 0.21
78 0.19
79 0.15
80 0.19
81 0.19
82 0.19
83 0.26
84 0.3
85 0.34
86 0.38
87 0.39
88 0.38
89 0.38
90 0.37
91 0.31
92 0.29
93 0.26
94 0.21
95 0.2
96 0.16
97 0.15
98 0.16
99 0.16
100 0.12
101 0.11
102 0.1
103 0.08
104 0.08
105 0.08
106 0.06
107 0.06
108 0.06
109 0.05
110 0.07
111 0.06
112 0.06
113 0.07
114 0.07
115 0.06
116 0.07
117 0.08
118 0.09
119 0.13
120 0.12
121 0.12
122 0.13
123 0.13
124 0.13
125 0.12
126 0.12
127 0.08
128 0.11
129 0.12
130 0.11
131 0.11
132 0.11
133 0.12
134 0.11
135 0.12
136 0.1
137 0.1
138 0.11
139 0.13
140 0.15
141 0.14
142 0.15
143 0.18
144 0.19
145 0.21
146 0.24
147 0.23
148 0.21
149 0.24
150 0.27
151 0.25
152 0.26
153 0.25
154 0.26
155 0.27
156 0.26
157 0.23
158 0.18
159 0.17
160 0.18
161 0.18
162 0.12
163 0.11