Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0K9P4

Protein Details
Accession R0K9P4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
274-294LAPLSKKEAAKKKARQQRDGGHydrophilic
NLS Segment(s)
PositionSequence
212-215RERR
279-289KKEAAKKKARQ
324-358LEKSRKRPVGDGPRGSGSAAGDAFEKRRKIVGRYK
Subcellular Location(s) cyto 12.5, cyto_nucl 9, mito 5, nucl 4.5, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
Pfam View protein in Pfam  
PF04000  Sas10_Utp3  
Amino Acid Sequences MAVDNSLESLLATLTTSIQSATEALPNDGILPPKEGISLLDVKNELLLSYLQNLVFLILMKLRLQKEGQKEAHLHPHDEVVQKLVELRVYLEKGVRPLESRLKYQIDKILRTADDATRRHTQAPTKLASRPKNAKADTGSDSDVSDAESAGSAQTEEDEDEMAYGPRRAQVTRQKTEAAQERARETAKDAIYRPPKITPMAMPTPEGREARRERRPGKSATLDEFIATELSTAPIAEPSIGSTITQGGRHTKSERERREENERREYEEANFTRLAPLSKKEAAKKKARQQRDGGFGGEEWRSLGAGIDRIERLTQKKGGNLGSLEKSRKRPVGDGPRGSGSAAGDAFEKRRKIVGRYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.07
5 0.08
6 0.08
7 0.09
8 0.1
9 0.13
10 0.14
11 0.15
12 0.15
13 0.15
14 0.16
15 0.16
16 0.18
17 0.15
18 0.17
19 0.17
20 0.17
21 0.17
22 0.16
23 0.15
24 0.16
25 0.22
26 0.19
27 0.23
28 0.23
29 0.22
30 0.23
31 0.22
32 0.17
33 0.12
34 0.12
35 0.09
36 0.11
37 0.14
38 0.13
39 0.13
40 0.13
41 0.12
42 0.11
43 0.1
44 0.09
45 0.08
46 0.09
47 0.11
48 0.17
49 0.18
50 0.21
51 0.23
52 0.29
53 0.36
54 0.44
55 0.45
56 0.44
57 0.47
58 0.48
59 0.56
60 0.51
61 0.45
62 0.36
63 0.37
64 0.36
65 0.34
66 0.3
67 0.22
68 0.2
69 0.18
70 0.19
71 0.16
72 0.12
73 0.1
74 0.12
75 0.14
76 0.15
77 0.16
78 0.18
79 0.18
80 0.2
81 0.22
82 0.21
83 0.18
84 0.23
85 0.31
86 0.31
87 0.33
88 0.36
89 0.4
90 0.39
91 0.41
92 0.43
93 0.39
94 0.38
95 0.37
96 0.37
97 0.31
98 0.33
99 0.32
100 0.29
101 0.32
102 0.31
103 0.34
104 0.34
105 0.36
106 0.36
107 0.37
108 0.38
109 0.37
110 0.42
111 0.41
112 0.38
113 0.42
114 0.48
115 0.5
116 0.52
117 0.53
118 0.55
119 0.59
120 0.57
121 0.56
122 0.5
123 0.48
124 0.43
125 0.38
126 0.32
127 0.24
128 0.23
129 0.19
130 0.16
131 0.12
132 0.09
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.06
151 0.06
152 0.06
153 0.08
154 0.1
155 0.1
156 0.17
157 0.26
158 0.35
159 0.38
160 0.4
161 0.38
162 0.38
163 0.43
164 0.43
165 0.4
166 0.34
167 0.32
168 0.31
169 0.32
170 0.32
171 0.27
172 0.21
173 0.21
174 0.2
175 0.21
176 0.21
177 0.27
178 0.33
179 0.34
180 0.34
181 0.29
182 0.3
183 0.28
184 0.28
185 0.22
186 0.22
187 0.24
188 0.23
189 0.23
190 0.22
191 0.23
192 0.26
193 0.25
194 0.2
195 0.24
196 0.31
197 0.38
198 0.45
199 0.51
200 0.52
201 0.59
202 0.64
203 0.6
204 0.6
205 0.58
206 0.53
207 0.48
208 0.45
209 0.37
210 0.32
211 0.28
212 0.21
213 0.14
214 0.11
215 0.07
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.06
227 0.07
228 0.06
229 0.06
230 0.1
231 0.11
232 0.12
233 0.13
234 0.18
235 0.2
236 0.24
237 0.26
238 0.3
239 0.38
240 0.48
241 0.54
242 0.56
243 0.59
244 0.61
245 0.7
246 0.73
247 0.71
248 0.71
249 0.65
250 0.63
251 0.6
252 0.56
253 0.48
254 0.48
255 0.41
256 0.34
257 0.33
258 0.27
259 0.27
260 0.27
261 0.26
262 0.19
263 0.21
264 0.24
265 0.29
266 0.34
267 0.41
268 0.49
269 0.55
270 0.63
271 0.69
272 0.73
273 0.77
274 0.81
275 0.8
276 0.79
277 0.79
278 0.77
279 0.69
280 0.61
281 0.52
282 0.43
283 0.39
284 0.3
285 0.22
286 0.14
287 0.12
288 0.11
289 0.09
290 0.1
291 0.09
292 0.12
293 0.13
294 0.16
295 0.16
296 0.17
297 0.19
298 0.22
299 0.25
300 0.28
301 0.33
302 0.33
303 0.37
304 0.41
305 0.42
306 0.42
307 0.4
308 0.4
309 0.4
310 0.44
311 0.47
312 0.48
313 0.52
314 0.55
315 0.59
316 0.57
317 0.55
318 0.6
319 0.64
320 0.68
321 0.67
322 0.64
323 0.62
324 0.58
325 0.53
326 0.44
327 0.33
328 0.27
329 0.21
330 0.17
331 0.15
332 0.17
333 0.22
334 0.26
335 0.27
336 0.25
337 0.32
338 0.36