Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0ITQ5

Protein Details
Accession R0ITQ5   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-93GSGSKKTKSVRLKQEQPPSPAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
Amino Acid Sequences MLAHHGSHRDNFGRLEGPRSPKYLSAGQAQLLPRKRSAPTRKTLQSHKLRIITSPAAPAYRPSTNSIDFTTTGSGSKKTKSVRLKQEQPPSPAMSGYSYSSSGQGNYSYQPPYQPGIPQYTQHQIHAYYAQYQCYPPEPWQMVQEYYVEQQPMSIPHTAYQEPVTGYESTGWQLQDTDVNVSASPGQKRTWTCDIPTCTSSAQFTRLADLQRHQSTVHGVGTPEYPCHVARCNRVGEKGFTRRDHLVEHLRNFHHIDIPRRKPGERSAFPFGWPEGGVGGAAGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.36
4 0.41
5 0.42
6 0.44
7 0.42
8 0.39
9 0.43
10 0.43
11 0.39
12 0.38
13 0.37
14 0.35
15 0.38
16 0.38
17 0.41
18 0.42
19 0.42
20 0.38
21 0.39
22 0.42
23 0.48
24 0.56
25 0.57
26 0.58
27 0.65
28 0.71
29 0.73
30 0.78
31 0.78
32 0.77
33 0.76
34 0.75
35 0.71
36 0.63
37 0.59
38 0.56
39 0.5
40 0.41
41 0.37
42 0.31
43 0.26
44 0.26
45 0.26
46 0.25
47 0.25
48 0.25
49 0.26
50 0.29
51 0.3
52 0.32
53 0.31
54 0.29
55 0.26
56 0.25
57 0.23
58 0.18
59 0.18
60 0.17
61 0.19
62 0.18
63 0.19
64 0.23
65 0.25
66 0.33
67 0.41
68 0.49
69 0.57
70 0.65
71 0.72
72 0.75
73 0.82
74 0.8
75 0.75
76 0.69
77 0.61
78 0.51
79 0.42
80 0.34
81 0.25
82 0.2
83 0.17
84 0.15
85 0.13
86 0.13
87 0.14
88 0.14
89 0.13
90 0.12
91 0.11
92 0.11
93 0.11
94 0.14
95 0.14
96 0.14
97 0.15
98 0.16
99 0.16
100 0.16
101 0.17
102 0.17
103 0.21
104 0.22
105 0.22
106 0.23
107 0.29
108 0.29
109 0.27
110 0.26
111 0.21
112 0.21
113 0.22
114 0.19
115 0.18
116 0.18
117 0.18
118 0.17
119 0.17
120 0.16
121 0.17
122 0.18
123 0.13
124 0.19
125 0.19
126 0.19
127 0.21
128 0.22
129 0.2
130 0.19
131 0.18
132 0.13
133 0.12
134 0.13
135 0.11
136 0.09
137 0.08
138 0.08
139 0.09
140 0.1
141 0.1
142 0.09
143 0.11
144 0.15
145 0.15
146 0.15
147 0.14
148 0.14
149 0.13
150 0.14
151 0.14
152 0.11
153 0.11
154 0.11
155 0.1
156 0.1
157 0.12
158 0.11
159 0.08
160 0.09
161 0.09
162 0.1
163 0.1
164 0.11
165 0.1
166 0.1
167 0.1
168 0.1
169 0.12
170 0.14
171 0.15
172 0.15
173 0.15
174 0.19
175 0.21
176 0.27
177 0.33
178 0.31
179 0.32
180 0.38
181 0.42
182 0.41
183 0.41
184 0.36
185 0.29
186 0.27
187 0.27
188 0.21
189 0.2
190 0.18
191 0.17
192 0.19
193 0.21
194 0.23
195 0.23
196 0.25
197 0.3
198 0.29
199 0.3
200 0.27
201 0.25
202 0.26
203 0.27
204 0.25
205 0.19
206 0.17
207 0.17
208 0.19
209 0.19
210 0.16
211 0.14
212 0.15
213 0.14
214 0.16
215 0.22
216 0.25
217 0.32
218 0.37
219 0.43
220 0.44
221 0.49
222 0.5
223 0.49
224 0.52
225 0.55
226 0.57
227 0.52
228 0.54
229 0.52
230 0.51
231 0.47
232 0.46
233 0.47
234 0.47
235 0.49
236 0.52
237 0.49
238 0.51
239 0.5
240 0.44
241 0.41
242 0.39
243 0.44
244 0.47
245 0.54
246 0.59
247 0.61
248 0.61
249 0.6
250 0.65
251 0.66
252 0.63
253 0.62
254 0.61
255 0.58
256 0.58
257 0.56
258 0.46
259 0.38
260 0.3
261 0.24
262 0.15
263 0.14
264 0.13