Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0IRP2

Protein Details
Accession R0IRP2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
162-185AEMNANRKRHRRSSSCKRCVRDEEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 5
Family & Domain DBs
Amino Acid Sequences MPRKIAQQVTMIRSDCAFCRKAELKGITVPQVCRFCGRRGKIFFRLPKPINVDREQRKVYIDTIPRMLSFTGGMPDVVGQVQRLHAQSLERKGGASANHDSQLSKVEGCTTITLQAEDTVLQTPAITVTSENSPPLMDVVTWTTFGCRTWQGVDMHLAFRAAEMNANRKRHRRSSSCKRCVRDEETNRKWGGVMAELRGTVAWEDELTEAAGVLKLQDEQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.3
4 0.27
5 0.21
6 0.29
7 0.32
8 0.35
9 0.42
10 0.42
11 0.39
12 0.43
13 0.46
14 0.44
15 0.44
16 0.42
17 0.41
18 0.41
19 0.38
20 0.39
21 0.39
22 0.4
23 0.46
24 0.49
25 0.51
26 0.56
27 0.63
28 0.65
29 0.71
30 0.73
31 0.7
32 0.74
33 0.67
34 0.66
35 0.66
36 0.63
37 0.61
38 0.57
39 0.6
40 0.57
41 0.63
42 0.58
43 0.52
44 0.48
45 0.43
46 0.39
47 0.38
48 0.35
49 0.3
50 0.31
51 0.31
52 0.28
53 0.27
54 0.25
55 0.18
56 0.13
57 0.11
58 0.09
59 0.09
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.05
67 0.06
68 0.07
69 0.09
70 0.1
71 0.1
72 0.11
73 0.13
74 0.18
75 0.22
76 0.23
77 0.21
78 0.2
79 0.2
80 0.21
81 0.19
82 0.19
83 0.17
84 0.16
85 0.18
86 0.18
87 0.17
88 0.15
89 0.17
90 0.14
91 0.11
92 0.09
93 0.09
94 0.1
95 0.1
96 0.11
97 0.08
98 0.1
99 0.1
100 0.1
101 0.09
102 0.08
103 0.08
104 0.07
105 0.08
106 0.06
107 0.06
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.04
115 0.05
116 0.08
117 0.09
118 0.09
119 0.09
120 0.08
121 0.08
122 0.08
123 0.07
124 0.05
125 0.05
126 0.08
127 0.09
128 0.09
129 0.09
130 0.1
131 0.1
132 0.1
133 0.12
134 0.1
135 0.11
136 0.12
137 0.18
138 0.18
139 0.19
140 0.22
141 0.21
142 0.21
143 0.19
144 0.18
145 0.12
146 0.12
147 0.12
148 0.08
149 0.1
150 0.12
151 0.21
152 0.27
153 0.34
154 0.4
155 0.46
156 0.54
157 0.59
158 0.67
159 0.68
160 0.72
161 0.77
162 0.84
163 0.86
164 0.87
165 0.82
166 0.8
167 0.78
168 0.76
169 0.75
170 0.75
171 0.75
172 0.73
173 0.76
174 0.68
175 0.6
176 0.52
177 0.43
178 0.35
179 0.3
180 0.26
181 0.21
182 0.23
183 0.22
184 0.22
185 0.2
186 0.18
187 0.12
188 0.1
189 0.08
190 0.07
191 0.08
192 0.08
193 0.09
194 0.09
195 0.08
196 0.07
197 0.07
198 0.08
199 0.06
200 0.06
201 0.07