Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0IL54

Protein Details
Accession R0IL54    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-46NNNNKPSLKSFKKPSKPRSRRQLAIAHydrophilic
NLS Segment(s)
PositionSequence
28-75LKSFKKPSKPRSRRQLAIASFNFKKQPVLSGRRVGRRPESGRLQRKPK
Subcellular Location(s) nucl 19.5, cyto_nucl 14.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MVELFGGHQQASNEFRITRYNNNNKPSLKSFKKPSKPRSRRQLAIASFNFKKQPVLSGRRVGRRPESGRLQRKPKESIVSAKRQNLISQLQSVKSVVVLLQLWWEPQGLHELLHRVVDGNDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.26
4 0.3
5 0.35
6 0.43
7 0.51
8 0.56
9 0.61
10 0.67
11 0.62
12 0.64
13 0.62
14 0.62
15 0.58
16 0.58
17 0.63
18 0.66
19 0.74
20 0.78
21 0.82
22 0.84
23 0.86
24 0.88
25 0.9
26 0.88
27 0.81
28 0.78
29 0.76
30 0.67
31 0.67
32 0.58
33 0.53
34 0.45
35 0.43
36 0.38
37 0.29
38 0.27
39 0.18
40 0.23
41 0.25
42 0.3
43 0.33
44 0.39
45 0.43
46 0.49
47 0.51
48 0.48
49 0.45
50 0.46
51 0.46
52 0.45
53 0.49
54 0.52
55 0.59
56 0.63
57 0.68
58 0.65
59 0.67
60 0.65
61 0.6
62 0.56
63 0.49
64 0.52
65 0.49
66 0.53
67 0.53
68 0.53
69 0.52
70 0.47
71 0.45
72 0.4
73 0.37
74 0.3
75 0.3
76 0.29
77 0.26
78 0.26
79 0.25
80 0.21
81 0.17
82 0.15
83 0.09
84 0.09
85 0.09
86 0.08
87 0.1
88 0.11
89 0.11
90 0.11
91 0.11
92 0.09
93 0.09
94 0.14
95 0.12
96 0.13
97 0.15
98 0.18
99 0.18
100 0.19
101 0.19
102 0.15