Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0IGT0

Protein Details
Accession R0IGT0   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
166-191VDEGATSAKKKRKEKKDKEKARFKPYBasic
NLS Segment(s)
PositionSequence
173-190AKKKRKEKKDKEKARFKP
Subcellular Location(s) cyto 18.5, cyto_nucl 13, nucl 4.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039328  WDR89  
Amino Acid Sequences MFDSAQADEDDALYQVINHGSAIAHAGFMYPSADIYALGTDETVSFYALQSQKEEEEEPAPKACGDVRQELDCEYVVDLCWVGPQPCVAAGKHSDKTLSLIPITKGTNGPLDYAFDLKNSTVLAGAHGEEIVRHLFIDMHTHTTYTCGEDGHIRAWKGTDDATMDVDEGATSAKKKRKEKKDKEKARFKPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.07
6 0.07
7 0.07
8 0.07
9 0.1
10 0.08
11 0.07
12 0.07
13 0.07
14 0.07
15 0.07
16 0.08
17 0.05
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.14
35 0.16
36 0.17
37 0.17
38 0.18
39 0.18
40 0.2
41 0.21
42 0.16
43 0.17
44 0.19
45 0.19
46 0.19
47 0.18
48 0.16
49 0.16
50 0.15
51 0.16
52 0.17
53 0.21
54 0.22
55 0.23
56 0.24
57 0.24
58 0.24
59 0.19
60 0.16
61 0.1
62 0.08
63 0.07
64 0.07
65 0.06
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.07
74 0.09
75 0.08
76 0.1
77 0.13
78 0.18
79 0.19
80 0.19
81 0.18
82 0.16
83 0.19
84 0.18
85 0.16
86 0.11
87 0.12
88 0.12
89 0.15
90 0.16
91 0.15
92 0.13
93 0.13
94 0.16
95 0.14
96 0.15
97 0.12
98 0.13
99 0.12
100 0.13
101 0.12
102 0.1
103 0.1
104 0.09
105 0.09
106 0.08
107 0.07
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.07
114 0.07
115 0.07
116 0.06
117 0.07
118 0.07
119 0.06
120 0.05
121 0.06
122 0.06
123 0.07
124 0.12
125 0.12
126 0.16
127 0.17
128 0.17
129 0.16
130 0.18
131 0.18
132 0.15
133 0.15
134 0.1
135 0.11
136 0.14
137 0.16
138 0.19
139 0.22
140 0.2
141 0.2
142 0.21
143 0.21
144 0.19
145 0.18
146 0.15
147 0.14
148 0.15
149 0.16
150 0.15
151 0.14
152 0.13
153 0.12
154 0.09
155 0.07
156 0.07
157 0.07
158 0.09
159 0.17
160 0.23
161 0.32
162 0.42
163 0.53
164 0.63
165 0.73
166 0.83
167 0.87
168 0.92
169 0.95
170 0.96
171 0.96