Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KQL5

Protein Details
Accession R0KQL5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
19-43HGLRLCTAISRRKRRKPSWSQHAVAHydrophilic
NLS Segment(s)
PositionSequence
29-35RRKRRKP
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MPSLATQARCIGAPAKPIHGLRLCTAISRRKRRKPSWSQHAVAASRPAPAEPPNLRTRVGSSNVQGLSKVLRPPPRLFATVTFAAVAKPHFAYEFGKIGPLPRYKAYPPRVRARHVPSLCAPAQGPVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.3
4 0.31
5 0.36
6 0.37
7 0.36
8 0.31
9 0.34
10 0.3
11 0.28
12 0.34
13 0.36
14 0.42
15 0.51
16 0.6
17 0.65
18 0.76
19 0.81
20 0.87
21 0.89
22 0.9
23 0.89
24 0.88
25 0.79
26 0.73
27 0.7
28 0.6
29 0.5
30 0.43
31 0.32
32 0.25
33 0.23
34 0.18
35 0.14
36 0.15
37 0.2
38 0.18
39 0.23
40 0.25
41 0.27
42 0.27
43 0.26
44 0.28
45 0.25
46 0.27
47 0.24
48 0.21
49 0.24
50 0.24
51 0.24
52 0.2
53 0.16
54 0.14
55 0.15
56 0.17
57 0.16
58 0.22
59 0.26
60 0.28
61 0.34
62 0.35
63 0.34
64 0.33
65 0.31
66 0.3
67 0.27
68 0.25
69 0.19
70 0.16
71 0.15
72 0.14
73 0.12
74 0.09
75 0.08
76 0.08
77 0.08
78 0.1
79 0.11
80 0.14
81 0.16
82 0.14
83 0.16
84 0.15
85 0.18
86 0.23
87 0.25
88 0.25
89 0.25
90 0.3
91 0.34
92 0.43
93 0.5
94 0.53
95 0.56
96 0.63
97 0.67
98 0.68
99 0.73
100 0.71
101 0.73
102 0.65
103 0.63
104 0.56
105 0.58
106 0.53
107 0.46
108 0.38