Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0K5F8

Protein Details
Accession R0K5F8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-70LLPASRRRTRLDPRRRRPWSLSHydrophilic
104-134TSTSVHPSIHPPRRRRRRRRPRLARLCFAASHydrophilic
NLS Segment(s)
PositionSequence
55-65RRTRLDPRRRR
114-126PPRRRRRRRRPRL
Subcellular Location(s) mito 8, nucl 5.5, extr 5, cyto_nucl 4.5, plas 4, cyto 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDSAALATRPSQPALDIGYCTICNCCMPPNTSKLAMLHGHAIGFLLAVLLPASRRRTRLDPRRRRPWSLSTTPTPTPTPTTPTPTPTTPTPTPTPTPTPTPTPTSTSVHPSIHPPRRRRRRRRPRLARLCFAASPSQLAARAVSQSAQFRSQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.18
4 0.17
5 0.18
6 0.18
7 0.18
8 0.17
9 0.13
10 0.12
11 0.12
12 0.16
13 0.17
14 0.21
15 0.24
16 0.28
17 0.31
18 0.32
19 0.33
20 0.29
21 0.3
22 0.28
23 0.25
24 0.23
25 0.19
26 0.17
27 0.15
28 0.14
29 0.09
30 0.08
31 0.06
32 0.04
33 0.03
34 0.03
35 0.03
36 0.03
37 0.04
38 0.08
39 0.14
40 0.16
41 0.18
42 0.23
43 0.31
44 0.42
45 0.52
46 0.6
47 0.66
48 0.73
49 0.82
50 0.84
51 0.81
52 0.76
53 0.74
54 0.71
55 0.67
56 0.62
57 0.55
58 0.54
59 0.49
60 0.46
61 0.38
62 0.31
63 0.28
64 0.23
65 0.24
66 0.21
67 0.27
68 0.26
69 0.29
70 0.31
71 0.28
72 0.3
73 0.27
74 0.32
75 0.26
76 0.29
77 0.29
78 0.29
79 0.3
80 0.31
81 0.35
82 0.3
83 0.34
84 0.33
85 0.35
86 0.34
87 0.37
88 0.35
89 0.35
90 0.36
91 0.34
92 0.33
93 0.34
94 0.35
95 0.31
96 0.29
97 0.33
98 0.39
99 0.46
100 0.52
101 0.55
102 0.63
103 0.73
104 0.83
105 0.87
106 0.89
107 0.91
108 0.94
109 0.97
110 0.97
111 0.97
112 0.97
113 0.95
114 0.9
115 0.84
116 0.78
117 0.67
118 0.59
119 0.51
120 0.4
121 0.34
122 0.28
123 0.24
124 0.2
125 0.19
126 0.18
127 0.15
128 0.16
129 0.15
130 0.15
131 0.17
132 0.22
133 0.24