Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0I6W9

Protein Details
Accession R0I6W9    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPRARAAQFRRPRRGRARPLWGGEHydrophilic
NLS Segment(s)
PositionSequence
9-18FRRPRRGRAR
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MPRARAAQFRRPRRGRARPLWGGEGAVDVSQSALGLIKVFQPASLLLEKLKSYRRAAPPPAPPQQNGTLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.84
4 0.84
5 0.8
6 0.78
7 0.72
8 0.61
9 0.51
10 0.4
11 0.31
12 0.21
13 0.14
14 0.09
15 0.05
16 0.05
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.05
25 0.06
26 0.06
27 0.06
28 0.06
29 0.07
30 0.09
31 0.1
32 0.1
33 0.09
34 0.11
35 0.12
36 0.15
37 0.21
38 0.23
39 0.26
40 0.35
41 0.43
42 0.49
43 0.56
44 0.61
45 0.64
46 0.68
47 0.73
48 0.68
49 0.61
50 0.59