Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0K388

Protein Details
Accession R0K388    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
164-189RTMVARARKSREPRPRKPVRNITLNFHydrophilic
NLS Segment(s)
PositionSequence
169-181RARKSREPRPRKP
Subcellular Location(s) nucl 12, cyto 11, mito 2
Family & Domain DBs
Amino Acid Sequences MGDLAVQFNAATPTNVDGVMVNAIASNSLSVRVGTEERLPGTYTLLISGNGTCNPSSSSSLCKMQPGLISSTQKTLVNGKMVYELVDPSKPSSESQAAAELSTDYLPLLDGSKQLLINTTDGQPQDTATLVAEPFATEHTVASNVYKASTQRGLGRMGFNLATRTMVARARKSREPRPRKPVRNITLNFGNRTQSEGSSEILHTTSLIWAFAALTIFHVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.1
5 0.11
6 0.11
7 0.1
8 0.08
9 0.07
10 0.07
11 0.07
12 0.07
13 0.06
14 0.05
15 0.07
16 0.07
17 0.07
18 0.08
19 0.1
20 0.12
21 0.13
22 0.16
23 0.18
24 0.18
25 0.2
26 0.2
27 0.17
28 0.18
29 0.18
30 0.14
31 0.13
32 0.13
33 0.12
34 0.12
35 0.12
36 0.12
37 0.12
38 0.13
39 0.12
40 0.12
41 0.13
42 0.15
43 0.17
44 0.16
45 0.2
46 0.22
47 0.27
48 0.27
49 0.27
50 0.25
51 0.24
52 0.26
53 0.23
54 0.23
55 0.24
56 0.27
57 0.26
58 0.27
59 0.27
60 0.25
61 0.24
62 0.24
63 0.21
64 0.22
65 0.21
66 0.19
67 0.19
68 0.18
69 0.18
70 0.15
71 0.13
72 0.11
73 0.12
74 0.11
75 0.11
76 0.12
77 0.12
78 0.12
79 0.15
80 0.15
81 0.15
82 0.16
83 0.18
84 0.16
85 0.15
86 0.15
87 0.11
88 0.09
89 0.08
90 0.07
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.06
99 0.07
100 0.07
101 0.07
102 0.09
103 0.09
104 0.1
105 0.11
106 0.11
107 0.13
108 0.12
109 0.13
110 0.11
111 0.11
112 0.1
113 0.09
114 0.08
115 0.06
116 0.07
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.05
123 0.06
124 0.05
125 0.05
126 0.06
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.1
134 0.1
135 0.13
136 0.16
137 0.17
138 0.19
139 0.22
140 0.24
141 0.25
142 0.26
143 0.22
144 0.22
145 0.21
146 0.17
147 0.16
148 0.13
149 0.12
150 0.11
151 0.11
152 0.12
153 0.16
154 0.2
155 0.27
156 0.34
157 0.4
158 0.48
159 0.54
160 0.62
161 0.68
162 0.74
163 0.77
164 0.8
165 0.85
166 0.87
167 0.9
168 0.91
169 0.87
170 0.87
171 0.79
172 0.75
173 0.74
174 0.69
175 0.61
176 0.52
177 0.48
178 0.38
179 0.4
180 0.34
181 0.25
182 0.25
183 0.23
184 0.22
185 0.21
186 0.21
187 0.18
188 0.17
189 0.16
190 0.12
191 0.11
192 0.12
193 0.1
194 0.1
195 0.09
196 0.08
197 0.09
198 0.1
199 0.1
200 0.07