Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0J5U4

Protein Details
Accession R0J5U4   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-99GHKTGHHRRGLRRIRRWLKRIANVVBasic
NLS Segment(s)
PositionSequence
77-94KTGHHRRGLRRIRRWLKR
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 6.5, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASIRTPSEASFDLHTDYFADFDGAHCTPENESSNDRFEDESLDAPSENNNPEEVSQHMSHHPGVTGDEQEDRAGHKTGHHRRGLRRIRRWLKRIANVVLVCTIGLMFHPQGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.16
4 0.15
5 0.13
6 0.11
7 0.1
8 0.07
9 0.08
10 0.12
11 0.11
12 0.12
13 0.12
14 0.12
15 0.13
16 0.18
17 0.2
18 0.18
19 0.21
20 0.23
21 0.25
22 0.25
23 0.25
24 0.21
25 0.18
26 0.18
27 0.16
28 0.15
29 0.13
30 0.12
31 0.11
32 0.11
33 0.12
34 0.11
35 0.11
36 0.1
37 0.1
38 0.09
39 0.1
40 0.11
41 0.11
42 0.13
43 0.12
44 0.13
45 0.14
46 0.15
47 0.15
48 0.14
49 0.13
50 0.1
51 0.1
52 0.1
53 0.1
54 0.09
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.11
61 0.12
62 0.11
63 0.15
64 0.25
65 0.35
66 0.43
67 0.48
68 0.52
69 0.58
70 0.69
71 0.75
72 0.75
73 0.75
74 0.78
75 0.82
76 0.86
77 0.84
78 0.83
79 0.82
80 0.8
81 0.78
82 0.71
83 0.69
84 0.59
85 0.55
86 0.46
87 0.36
88 0.28
89 0.2
90 0.16
91 0.07
92 0.07
93 0.1