Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KJI2

Protein Details
Accession R0KJI2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-95FLLTMRKKKTFTKSEKKKKRBasic
NLS Segment(s)
PositionSequence
81-95RKKKTFTKSEKKKKR
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MYNKAPITAATHKVYHAHSRFSMCKAHSPTPDTCSLQMRVTSSMACRLACEAALVSPSYNLPNQASGVSIQVRKLFLLTMRKKKTFTKSEKKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.36
4 0.35
5 0.34
6 0.39
7 0.41
8 0.4
9 0.43
10 0.34
11 0.4
12 0.41
13 0.45
14 0.43
15 0.45
16 0.45
17 0.43
18 0.46
19 0.4
20 0.35
21 0.32
22 0.3
23 0.27
24 0.26
25 0.23
26 0.2
27 0.19
28 0.18
29 0.14
30 0.17
31 0.16
32 0.15
33 0.13
34 0.12
35 0.12
36 0.11
37 0.1
38 0.06
39 0.05
40 0.06
41 0.06
42 0.05
43 0.05
44 0.06
45 0.07
46 0.08
47 0.09
48 0.09
49 0.1
50 0.11
51 0.1
52 0.11
53 0.1
54 0.12
55 0.14
56 0.14
57 0.15
58 0.17
59 0.17
60 0.17
61 0.17
62 0.15
63 0.17
64 0.27
65 0.35
66 0.43
67 0.51
68 0.55
69 0.58
70 0.65
71 0.7
72 0.7
73 0.72
74 0.72
75 0.76