Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0IPM5

Protein Details
Accession R0IPM5   
Localization Confidence High
Confidence Score 21.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-33GSAPAQYKQSSRKGKKAWRKNVDVTQIQSHydrophilic
258-299FSDSENKEAKKKRPERKTPSQRNKIKKRKEGERKAKHEAKMKBasic
NLS Segment(s)
PositionSequence
17-20KGKK
107-112KRKKAK
163-191KKPKVEPKTLKRAPVSQAKSGKTIPAVRK
264-302KEAKKKRPERKTPSQRNKIKKRKEGERKAKHEAKMKAKE
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0000027  P:ribosomal large subunit assembly  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences MADTGSAPAQYKQSSRKGKKAWRKNVDVTQIQSGLDEVRDQIIHGGVVAEKTSDELFAVDTIGSAEIQKSVAKRHKPLKVDEILARRSAVPAVSTRKRLSDIADDGKRKKAKVSSKEYDRLRAIAYGGEQVKKDVVQTSDAMYDPWAVQEARKDPKFEYLEEKKPKVEPKTLKRAPVSQAKSGKTIPAVRKPAGGKSYNPLLEDWQNELMRESDKIVEAEKKRLEEAREEAERMERAAAEIESDSGEESVWESEWEGFSDSENKEAKKKRPERKTPSQRNKIKKRKEGERKAKHEAKMKAKEQQLQEIKRLAKSVEEKERARATVRQALEQKNAEEFEDDGEEVELRKKQFGKAPLPEAPLEVVLPDELRDSLRLLKPEGNLLKDRFRNMMLQGKVEARRQIPYAKQKKYTVSEKWSYKDWQLPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.67
4 0.73
5 0.81
6 0.86
7 0.89
8 0.9
9 0.89
10 0.89
11 0.89
12 0.87
13 0.86
14 0.8
15 0.73
16 0.68
17 0.59
18 0.5
19 0.41
20 0.32
21 0.24
22 0.19
23 0.16
24 0.1
25 0.12
26 0.12
27 0.12
28 0.13
29 0.12
30 0.11
31 0.1
32 0.1
33 0.09
34 0.09
35 0.09
36 0.08
37 0.07
38 0.09
39 0.09
40 0.08
41 0.08
42 0.07
43 0.08
44 0.08
45 0.09
46 0.07
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.08
55 0.1
56 0.11
57 0.2
58 0.29
59 0.35
60 0.43
61 0.52
62 0.58
63 0.62
64 0.67
65 0.67
66 0.64
67 0.62
68 0.6
69 0.58
70 0.53
71 0.49
72 0.43
73 0.34
74 0.3
75 0.26
76 0.19
77 0.14
78 0.17
79 0.25
80 0.29
81 0.35
82 0.35
83 0.37
84 0.39
85 0.39
86 0.37
87 0.36
88 0.37
89 0.4
90 0.46
91 0.49
92 0.48
93 0.56
94 0.55
95 0.48
96 0.47
97 0.47
98 0.5
99 0.54
100 0.62
101 0.63
102 0.69
103 0.76
104 0.73
105 0.71
106 0.63
107 0.54
108 0.45
109 0.37
110 0.29
111 0.22
112 0.2
113 0.18
114 0.19
115 0.19
116 0.18
117 0.18
118 0.18
119 0.17
120 0.17
121 0.15
122 0.14
123 0.14
124 0.15
125 0.16
126 0.17
127 0.16
128 0.15
129 0.12
130 0.12
131 0.1
132 0.09
133 0.09
134 0.08
135 0.08
136 0.13
137 0.19
138 0.25
139 0.28
140 0.29
141 0.28
142 0.37
143 0.38
144 0.35
145 0.39
146 0.39
147 0.46
148 0.51
149 0.52
150 0.46
151 0.48
152 0.53
153 0.49
154 0.51
155 0.51
156 0.52
157 0.62
158 0.64
159 0.65
160 0.61
161 0.61
162 0.57
163 0.57
164 0.52
165 0.49
166 0.51
167 0.47
168 0.47
169 0.43
170 0.39
171 0.33
172 0.35
173 0.33
174 0.35
175 0.38
176 0.36
177 0.4
178 0.4
179 0.41
180 0.39
181 0.36
182 0.29
183 0.27
184 0.33
185 0.29
186 0.28
187 0.24
188 0.21
189 0.22
190 0.22
191 0.21
192 0.19
193 0.18
194 0.17
195 0.18
196 0.16
197 0.14
198 0.13
199 0.12
200 0.08
201 0.09
202 0.09
203 0.1
204 0.16
205 0.17
206 0.23
207 0.23
208 0.23
209 0.24
210 0.26
211 0.26
212 0.23
213 0.25
214 0.25
215 0.24
216 0.24
217 0.23
218 0.22
219 0.21
220 0.18
221 0.15
222 0.09
223 0.08
224 0.09
225 0.08
226 0.07
227 0.06
228 0.06
229 0.06
230 0.06
231 0.06
232 0.05
233 0.05
234 0.04
235 0.05
236 0.04
237 0.04
238 0.05
239 0.05
240 0.06
241 0.06
242 0.07
243 0.08
244 0.07
245 0.08
246 0.14
247 0.13
248 0.18
249 0.2
250 0.21
251 0.27
252 0.34
253 0.42
254 0.47
255 0.57
256 0.61
257 0.7
258 0.8
259 0.82
260 0.86
261 0.9
262 0.91
263 0.92
264 0.93
265 0.91
266 0.91
267 0.93
268 0.92
269 0.91
270 0.88
271 0.86
272 0.86
273 0.88
274 0.89
275 0.89
276 0.89
277 0.86
278 0.87
279 0.86
280 0.8
281 0.78
282 0.75
283 0.74
284 0.73
285 0.69
286 0.66
287 0.64
288 0.65
289 0.59
290 0.6
291 0.59
292 0.52
293 0.53
294 0.52
295 0.49
296 0.44
297 0.43
298 0.33
299 0.31
300 0.34
301 0.38
302 0.42
303 0.46
304 0.46
305 0.51
306 0.54
307 0.49
308 0.46
309 0.42
310 0.39
311 0.4
312 0.4
313 0.41
314 0.44
315 0.47
316 0.5
317 0.48
318 0.43
319 0.38
320 0.37
321 0.31
322 0.25
323 0.21
324 0.16
325 0.15
326 0.14
327 0.11
328 0.11
329 0.1
330 0.1
331 0.14
332 0.15
333 0.15
334 0.2
335 0.21
336 0.26
337 0.32
338 0.4
339 0.46
340 0.49
341 0.55
342 0.56
343 0.57
344 0.53
345 0.47
346 0.4
347 0.31
348 0.24
349 0.17
350 0.12
351 0.09
352 0.09
353 0.08
354 0.08
355 0.08
356 0.09
357 0.1
358 0.11
359 0.19
360 0.22
361 0.25
362 0.27
363 0.31
364 0.31
365 0.4
366 0.43
367 0.4
368 0.42
369 0.44
370 0.5
371 0.49
372 0.51
373 0.45
374 0.42
375 0.41
376 0.4
377 0.45
378 0.38
379 0.37
380 0.37
381 0.41
382 0.43
383 0.44
384 0.45
385 0.38
386 0.4
387 0.4
388 0.45
389 0.47
390 0.54
391 0.6
392 0.62
393 0.68
394 0.7
395 0.75
396 0.76
397 0.76
398 0.74
399 0.73
400 0.74
401 0.73
402 0.71
403 0.68
404 0.64
405 0.61