Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5ALU1

Protein Details
Accession Q5ALU1   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
80-107KYTTFNRHSKNYRKPVHRVPKWTKLSFRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 13.5, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG cal:CAALFM_C201740CA  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFESLVRSGGYVWKFTSRLTTTQKYKLRSRMKQVDENIKNIYQGLIAMENKSMGEPTGLKKIDYLQFEFPKENEMTTRDKYTTFNRHSKNYRKPVHRVPKWTKLSFRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.31
4 0.28
5 0.34
6 0.4
7 0.46
8 0.47
9 0.56
10 0.62
11 0.59
12 0.64
13 0.67
14 0.69
15 0.68
16 0.73
17 0.73
18 0.74
19 0.76
20 0.74
21 0.75
22 0.67
23 0.63
24 0.56
25 0.46
26 0.39
27 0.32
28 0.25
29 0.14
30 0.11
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.09
39 0.08
40 0.05
41 0.05
42 0.06
43 0.08
44 0.15
45 0.15
46 0.15
47 0.15
48 0.19
49 0.23
50 0.24
51 0.25
52 0.24
53 0.27
54 0.29
55 0.29
56 0.26
57 0.25
58 0.23
59 0.21
60 0.16
61 0.17
62 0.2
63 0.22
64 0.26
65 0.22
66 0.23
67 0.26
68 0.33
69 0.4
70 0.42
71 0.48
72 0.49
73 0.57
74 0.65
75 0.72
76 0.75
77 0.75
78 0.77
79 0.76
80 0.8
81 0.83
82 0.85
83 0.83
84 0.83
85 0.81
86 0.82
87 0.84
88 0.82
89 0.79
90 0.75
91 0.76
92 0.74
93 0.76