Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0J5V3

Protein Details
Accession R0J5V3   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-70EMSREEKLSRRRRAKERAKKAGLNBasic
NLS Segment(s)
PositionSequence
52-91EKLSRRRRAKERAKKAGLNKPKPTTTAEPKDTKKRGDKKQ
Subcellular Location(s) nucl 11.5, cyto_nucl 11, cyto 9.5, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012173  Mpp10  
Gene Ontology GO:0034457  C:Mpp10 complex  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04006  Mpp10  
Amino Acid Sequences MEDARPTAGGDVAAASMLAPQEIYKPGDAQSKTEIVTKSGMPVAREEMSREEKLSRRRRAKERAKKAGLNKPKPTTTAEPKDTKKRGDKKQLLGDLKKGGVQIIGRKGALTDVEGNEVKDAVTKGAGSYKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.07
9 0.1
10 0.12
11 0.12
12 0.13
13 0.16
14 0.23
15 0.24
16 0.24
17 0.25
18 0.25
19 0.25
20 0.29
21 0.27
22 0.21
23 0.22
24 0.2
25 0.18
26 0.19
27 0.2
28 0.15
29 0.16
30 0.18
31 0.18
32 0.18
33 0.18
34 0.2
35 0.23
36 0.23
37 0.23
38 0.24
39 0.27
40 0.37
41 0.45
42 0.5
43 0.54
44 0.62
45 0.69
46 0.77
47 0.83
48 0.84
49 0.84
50 0.85
51 0.81
52 0.78
53 0.77
54 0.75
55 0.75
56 0.72
57 0.68
58 0.62
59 0.58
60 0.55
61 0.52
62 0.49
63 0.48
64 0.48
65 0.47
66 0.5
67 0.53
68 0.61
69 0.6
70 0.6
71 0.61
72 0.62
73 0.66
74 0.71
75 0.74
76 0.72
77 0.77
78 0.79
79 0.77
80 0.7
81 0.64
82 0.56
83 0.49
84 0.42
85 0.33
86 0.25
87 0.19
88 0.19
89 0.21
90 0.23
91 0.25
92 0.23
93 0.23
94 0.23
95 0.22
96 0.21
97 0.17
98 0.16
99 0.14
100 0.19
101 0.2
102 0.2
103 0.19
104 0.19
105 0.16
106 0.15
107 0.15
108 0.11
109 0.11
110 0.11
111 0.12