Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KT72

Protein Details
Accession R0KT72    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-45QVEPQEKKKTPKGRAKKRLTYTRRFVHydrophilic
NLS Segment(s)
PositionSequence
25-37EKKKTPKGRAKKR
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQNPQVEPQEKKKTPKGRAKKRLTYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.49
4 0.5
5 0.5
6 0.58
7 0.58
8 0.58
9 0.59
10 0.61
11 0.62
12 0.6
13 0.62
14 0.63
15 0.65
16 0.66
17 0.71
18 0.74
19 0.74
20 0.81
21 0.85
22 0.86
23 0.86
24 0.87
25 0.85
26 0.83
27 0.79
28 0.77
29 0.73
30 0.66
31 0.58
32 0.54
33 0.49
34 0.43
35 0.42
36 0.36
37 0.35
38 0.35
39 0.37
40 0.37
41 0.42
42 0.48