Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0KN12

Protein Details
Accession R0KN12   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-57YTLPRLPHPPHPQRPTPKSTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14, cyto_mito 11.333, cyto_nucl 8.833, mito 7.5, extr 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF12754  Blt1  
PF17183  Blt1_C  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MSELAFCKSFLSALDARPVKLSSDHIADARQYPAQGAYTLPRLPHPPHPQRPTPKSTDGNEASASSTSTITVTLKPMKPSTPTIPLSDIDPAKTSVYDLKQQYATKASLSAAKIKILYKKKPVTDSKMLLEVIGADAGADVEFGVMVMAGAAAASSPAAGNTPVTSPPAVAPPTESEKGLASAGETSGGAVPGASASGKEVVATEEFWGDLKTFILQRIKDAEEGERLVGVFKSAWEQNQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.29
4 0.31
5 0.31
6 0.26
7 0.26
8 0.28
9 0.23
10 0.25
11 0.27
12 0.25
13 0.26
14 0.26
15 0.26
16 0.25
17 0.22
18 0.18
19 0.17
20 0.17
21 0.17
22 0.15
23 0.14
24 0.15
25 0.18
26 0.2
27 0.19
28 0.2
29 0.24
30 0.27
31 0.36
32 0.44
33 0.5
34 0.58
35 0.65
36 0.71
37 0.77
38 0.81
39 0.78
40 0.74
41 0.72
42 0.68
43 0.63
44 0.63
45 0.55
46 0.5
47 0.44
48 0.38
49 0.31
50 0.25
51 0.22
52 0.14
53 0.11
54 0.09
55 0.08
56 0.09
57 0.09
58 0.09
59 0.13
60 0.19
61 0.21
62 0.24
63 0.26
64 0.27
65 0.29
66 0.33
67 0.34
68 0.35
69 0.34
70 0.33
71 0.34
72 0.32
73 0.3
74 0.29
75 0.25
76 0.18
77 0.17
78 0.16
79 0.14
80 0.14
81 0.13
82 0.13
83 0.15
84 0.2
85 0.2
86 0.21
87 0.25
88 0.25
89 0.26
90 0.25
91 0.23
92 0.17
93 0.17
94 0.15
95 0.16
96 0.16
97 0.2
98 0.18
99 0.18
100 0.19
101 0.2
102 0.28
103 0.3
104 0.34
105 0.37
106 0.42
107 0.44
108 0.5
109 0.53
110 0.53
111 0.53
112 0.51
113 0.44
114 0.42
115 0.39
116 0.3
117 0.25
118 0.17
119 0.11
120 0.08
121 0.06
122 0.03
123 0.03
124 0.03
125 0.03
126 0.02
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.01
139 0.01
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.03
146 0.04
147 0.04
148 0.05
149 0.07
150 0.07
151 0.09
152 0.09
153 0.09
154 0.1
155 0.14
156 0.14
157 0.12
158 0.13
159 0.16
160 0.22
161 0.22
162 0.22
163 0.18
164 0.19
165 0.2
166 0.18
167 0.15
168 0.09
169 0.09
170 0.08
171 0.08
172 0.07
173 0.06
174 0.07
175 0.07
176 0.06
177 0.05
178 0.05
179 0.04
180 0.05
181 0.04
182 0.04
183 0.05
184 0.07
185 0.07
186 0.07
187 0.08
188 0.09
189 0.1
190 0.11
191 0.1
192 0.09
193 0.09
194 0.1
195 0.1
196 0.09
197 0.08
198 0.08
199 0.1
200 0.12
201 0.17
202 0.23
203 0.23
204 0.26
205 0.31
206 0.33
207 0.32
208 0.33
209 0.31
210 0.29
211 0.3
212 0.26
213 0.22
214 0.2
215 0.19
216 0.17
217 0.15
218 0.1
219 0.1
220 0.14