Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R0JYA3

Protein Details
Accession R0JYA3   
Localization Confidence Low
Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-90LPSHSLAPLRKRLRKRCGSADGKDRMHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 9.5, nucl 4.5, mito 4, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences METSATSAAEYRSVRHLTAPIGTAISADILIGSDCWVAVPCAKPEHGWLASHWVIVVYINIIPSLPSHSLAPLRKRLRKRCGSADGKDRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.26
4 0.22
5 0.24
6 0.23
7 0.17
8 0.15
9 0.15
10 0.12
11 0.1
12 0.09
13 0.06
14 0.05
15 0.04
16 0.03
17 0.04
18 0.03
19 0.04
20 0.03
21 0.03
22 0.04
23 0.04
24 0.04
25 0.06
26 0.08
27 0.09
28 0.1
29 0.11
30 0.11
31 0.12
32 0.17
33 0.16
34 0.15
35 0.14
36 0.19
37 0.19
38 0.19
39 0.17
40 0.12
41 0.11
42 0.11
43 0.1
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.1
52 0.1
53 0.1
54 0.11
55 0.13
56 0.2
57 0.26
58 0.32
59 0.38
60 0.46
61 0.54
62 0.64
63 0.72
64 0.76
65 0.8
66 0.82
67 0.82
68 0.84
69 0.84
70 0.82