Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R0KDC7

Protein Details
Accession R0KDC7    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
181-206PSLLQFCYLRRRRRRQTKIQPHLLVLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, nucl 6, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MPAHGLPLLAWLLCAWSCACACARVPVCAYVRRPTLLDDASTALARKKKSQAPCWLAYDLGARAPCLRCMTRQELGDSRRAVIYEPLIIDTAAATSLSWRARAREGKAREGHGGQEWERGTRTAKDMPPPASTAAPATATATPIAPAAPAAAPAVAPAITTIATLPLLTPVPLHPHPTPSPSLLQFCYLRRRRRRQTKIQPHLLVLLAPPWPPLRPGSSRLAVPSVEPVEPAPVPHASAWSCRRAQMGARLQGKWHSSASRSGSTSGLLNRRRAVSAPFLVSRPLRGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.1
4 0.11
5 0.13
6 0.14
7 0.15
8 0.16
9 0.24
10 0.25
11 0.26
12 0.28
13 0.32
14 0.35
15 0.39
16 0.42
17 0.4
18 0.41
19 0.4
20 0.39
21 0.36
22 0.39
23 0.33
24 0.3
25 0.25
26 0.24
27 0.23
28 0.23
29 0.2
30 0.19
31 0.21
32 0.23
33 0.27
34 0.33
35 0.4
36 0.48
37 0.56
38 0.62
39 0.66
40 0.68
41 0.67
42 0.6
43 0.52
44 0.44
45 0.38
46 0.27
47 0.23
48 0.18
49 0.14
50 0.18
51 0.19
52 0.21
53 0.23
54 0.23
55 0.24
56 0.3
57 0.36
58 0.36
59 0.37
60 0.39
61 0.41
62 0.42
63 0.45
64 0.39
65 0.34
66 0.3
67 0.28
68 0.24
69 0.19
70 0.18
71 0.14
72 0.13
73 0.13
74 0.12
75 0.12
76 0.11
77 0.08
78 0.07
79 0.05
80 0.05
81 0.04
82 0.04
83 0.08
84 0.09
85 0.12
86 0.12
87 0.14
88 0.21
89 0.27
90 0.31
91 0.36
92 0.4
93 0.45
94 0.48
95 0.49
96 0.45
97 0.4
98 0.37
99 0.31
100 0.3
101 0.22
102 0.23
103 0.21
104 0.19
105 0.19
106 0.18
107 0.17
108 0.16
109 0.19
110 0.21
111 0.23
112 0.27
113 0.31
114 0.33
115 0.32
116 0.32
117 0.29
118 0.23
119 0.21
120 0.16
121 0.13
122 0.1
123 0.09
124 0.09
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.07
131 0.06
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.12
159 0.13
160 0.18
161 0.17
162 0.22
163 0.23
164 0.26
165 0.27
166 0.24
167 0.26
168 0.24
169 0.26
170 0.22
171 0.24
172 0.24
173 0.25
174 0.34
175 0.38
176 0.46
177 0.54
178 0.64
179 0.71
180 0.8
181 0.87
182 0.88
183 0.91
184 0.93
185 0.93
186 0.92
187 0.83
188 0.73
189 0.65
190 0.54
191 0.42
192 0.31
193 0.23
194 0.14
195 0.12
196 0.12
197 0.11
198 0.11
199 0.12
200 0.14
201 0.18
202 0.2
203 0.25
204 0.3
205 0.31
206 0.32
207 0.32
208 0.33
209 0.27
210 0.24
211 0.24
212 0.21
213 0.18
214 0.17
215 0.16
216 0.17
217 0.17
218 0.16
219 0.14
220 0.12
221 0.14
222 0.13
223 0.16
224 0.14
225 0.22
226 0.26
227 0.3
228 0.3
229 0.31
230 0.33
231 0.32
232 0.35
233 0.37
234 0.42
235 0.45
236 0.49
237 0.47
238 0.47
239 0.51
240 0.48
241 0.41
242 0.36
243 0.31
244 0.28
245 0.35
246 0.39
247 0.39
248 0.38
249 0.37
250 0.34
251 0.31
252 0.33
253 0.32
254 0.36
255 0.35
256 0.38
257 0.41
258 0.43
259 0.44
260 0.42
261 0.4
262 0.39
263 0.39
264 0.4
265 0.38
266 0.37
267 0.4
268 0.39