Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2SQ34

Protein Details
Accession M2SQ34    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
274-309MYLISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRTBasic
NLS Segment(s)
PositionSequence
280-308KRQRKLKMKKHKYKKLMKRTRLLRRKLDR
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG bsc:COCSADRAFT_153554  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFSPAVGRVARSANTLSAAPFAALNACTRSALSTSSAPQQPFRPSHQRRYSSSKPSTPANNKKKPAELDQNATAELQGAEQKTKGQKKLKQPSTATLGNNVPFVPPTNHLREDDVKLSAFFGLHRPISISRAFPNSTSTAEFDAFFDVNRASQVERIEATKNVLSGFLERMHAELDAQEEQRADATQSEQQVYHLDVQPTQHSVESWAARLVPFQPPAPPEPYDPLATEPETDSYSAEGLSASINQRITEVTLPSEESKLRSFRQHVAKRRYGMYLISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.19
4 0.17
5 0.16
6 0.14
7 0.12
8 0.11
9 0.11
10 0.11
11 0.12
12 0.12
13 0.13
14 0.13
15 0.13
16 0.15
17 0.14
18 0.15
19 0.16
20 0.17
21 0.19
22 0.26
23 0.31
24 0.31
25 0.33
26 0.36
27 0.41
28 0.42
29 0.47
30 0.51
31 0.54
32 0.63
33 0.7
34 0.72
35 0.7
36 0.75
37 0.76
38 0.76
39 0.76
40 0.72
41 0.65
42 0.64
43 0.68
44 0.7
45 0.72
46 0.72
47 0.73
48 0.74
49 0.75
50 0.76
51 0.71
52 0.68
53 0.68
54 0.63
55 0.59
56 0.57
57 0.54
58 0.47
59 0.42
60 0.33
61 0.23
62 0.18
63 0.12
64 0.11
65 0.1
66 0.11
67 0.11
68 0.16
69 0.24
70 0.3
71 0.38
72 0.44
73 0.5
74 0.6
75 0.71
76 0.75
77 0.75
78 0.71
79 0.68
80 0.66
81 0.64
82 0.53
83 0.47
84 0.41
85 0.33
86 0.31
87 0.26
88 0.19
89 0.14
90 0.16
91 0.14
92 0.14
93 0.18
94 0.23
95 0.25
96 0.26
97 0.3
98 0.31
99 0.32
100 0.31
101 0.27
102 0.22
103 0.2
104 0.2
105 0.16
106 0.12
107 0.09
108 0.1
109 0.11
110 0.11
111 0.11
112 0.13
113 0.13
114 0.16
115 0.17
116 0.16
117 0.15
118 0.19
119 0.19
120 0.18
121 0.2
122 0.19
123 0.19
124 0.18
125 0.17
126 0.15
127 0.15
128 0.15
129 0.12
130 0.12
131 0.11
132 0.09
133 0.09
134 0.07
135 0.07
136 0.07
137 0.07
138 0.06
139 0.08
140 0.09
141 0.09
142 0.09
143 0.11
144 0.12
145 0.12
146 0.14
147 0.12
148 0.12
149 0.11
150 0.11
151 0.09
152 0.09
153 0.1
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.09
160 0.08
161 0.07
162 0.08
163 0.09
164 0.1
165 0.1
166 0.09
167 0.1
168 0.1
169 0.1
170 0.08
171 0.07
172 0.08
173 0.1
174 0.12
175 0.13
176 0.13
177 0.13
178 0.14
179 0.14
180 0.16
181 0.17
182 0.16
183 0.16
184 0.18
185 0.18
186 0.19
187 0.18
188 0.14
189 0.11
190 0.13
191 0.17
192 0.16
193 0.16
194 0.15
195 0.14
196 0.14
197 0.15
198 0.15
199 0.15
200 0.16
201 0.16
202 0.18
203 0.2
204 0.23
205 0.26
206 0.25
207 0.23
208 0.26
209 0.28
210 0.26
211 0.25
212 0.24
213 0.23
214 0.22
215 0.21
216 0.17
217 0.16
218 0.15
219 0.15
220 0.13
221 0.11
222 0.1
223 0.09
224 0.08
225 0.06
226 0.06
227 0.06
228 0.08
229 0.09
230 0.12
231 0.12
232 0.12
233 0.13
234 0.13
235 0.15
236 0.15
237 0.15
238 0.14
239 0.14
240 0.17
241 0.18
242 0.2
243 0.18
244 0.19
245 0.22
246 0.25
247 0.27
248 0.33
249 0.36
250 0.42
251 0.52
252 0.59
253 0.64
254 0.7
255 0.74
256 0.71
257 0.69
258 0.65
259 0.56
260 0.48
261 0.45
262 0.44
263 0.39
264 0.45
265 0.49
266 0.5
267 0.55
268 0.6
269 0.62
270 0.63
271 0.72
272 0.73
273 0.77
274 0.84
275 0.88
276 0.92
277 0.95
278 0.95
279 0.95
280 0.95
281 0.95
282 0.94
283 0.93
284 0.92
285 0.92
286 0.92
287 0.92
288 0.9
289 0.89