Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2RHY7

Protein Details
Accession M2RHY7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
89-129GKKGRSFKGRRDKMKEHMKTVHDNRARKRRRIEESEEKDEDBasic
NLS Segment(s)
PositionSequence
88-119DGKKGRSFKGRRDKMKEHMKTVHDNRARKRRR
Subcellular Location(s) nucl 14.5, mito_nucl 12, mito 8.5, cyto 3
Family & Domain DBs
KEGG bsc:COCSADRAFT_84664  -  
Amino Acid Sequences SSSTATPTAVTTAQNTSISQATEVDPIVGQVTLGGRFTCLSKACRNDETLTFNRHADFKRHYTNMHARKLTEYFCPEKGCHRSRYPADGKKGRSFKGRRDKMKEHMKTVHDNRARKRRRIEESEEKDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.2
5 0.19
6 0.17
7 0.16
8 0.14
9 0.14
10 0.14
11 0.12
12 0.1
13 0.1
14 0.1
15 0.08
16 0.07
17 0.06
18 0.07
19 0.07
20 0.08
21 0.07
22 0.07
23 0.08
24 0.09
25 0.11
26 0.13
27 0.16
28 0.22
29 0.27
30 0.31
31 0.33
32 0.35
33 0.34
34 0.34
35 0.38
36 0.35
37 0.33
38 0.3
39 0.29
40 0.27
41 0.27
42 0.26
43 0.24
44 0.25
45 0.27
46 0.32
47 0.33
48 0.32
49 0.36
50 0.44
51 0.47
52 0.49
53 0.45
54 0.39
55 0.4
56 0.42
57 0.36
58 0.3
59 0.26
60 0.23
61 0.24
62 0.26
63 0.24
64 0.3
65 0.37
66 0.38
67 0.39
68 0.4
69 0.45
70 0.46
71 0.55
72 0.57
73 0.56
74 0.61
75 0.62
76 0.64
77 0.65
78 0.67
79 0.61
80 0.62
81 0.59
82 0.6
83 0.65
84 0.69
85 0.7
86 0.74
87 0.78
88 0.77
89 0.84
90 0.79
91 0.75
92 0.73
93 0.68
94 0.69
95 0.68
96 0.69
97 0.65
98 0.67
99 0.69
100 0.73
101 0.77
102 0.75
103 0.79
104 0.79
105 0.81
106 0.82
107 0.82
108 0.83
109 0.83