Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2SNL5

Protein Details
Accession M2SNL5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MGKRHNRKRTRSRPRNRNNNNNNNPNANHydrophilic
NLS Segment(s)
PositionSequence
3-16KRHNRKRTRSRPRN
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
KEGG bsc:COCSADRAFT_265866  -  
Amino Acid Sequences MGKRHNRKRTRSRPRNRNNNNNNNPNANNNLNINTTPIHIRSESVSTASSTLSPTSSCFQPSGCPLANVPANHWQQTYTAWQMRLRIQREQEQELELETQRLRIFGGLPEDERCLMEPMLKVVTDLFDGFYDYEDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.95
4 0.95
5 0.95
6 0.95
7 0.94
8 0.91
9 0.85
10 0.8
11 0.71
12 0.63
13 0.57
14 0.48
15 0.4
16 0.33
17 0.31
18 0.26
19 0.25
20 0.23
21 0.17
22 0.17
23 0.17
24 0.16
25 0.16
26 0.14
27 0.15
28 0.15
29 0.17
30 0.16
31 0.15
32 0.15
33 0.13
34 0.13
35 0.12
36 0.11
37 0.09
38 0.09
39 0.08
40 0.08
41 0.09
42 0.11
43 0.12
44 0.12
45 0.12
46 0.11
47 0.13
48 0.15
49 0.18
50 0.15
51 0.15
52 0.14
53 0.17
54 0.2
55 0.18
56 0.18
57 0.22
58 0.23
59 0.23
60 0.23
61 0.2
62 0.18
63 0.2
64 0.21
65 0.17
66 0.19
67 0.2
68 0.22
69 0.24
70 0.3
71 0.36
72 0.35
73 0.36
74 0.37
75 0.42
76 0.46
77 0.47
78 0.41
79 0.35
80 0.32
81 0.28
82 0.26
83 0.19
84 0.16
85 0.13
86 0.14
87 0.13
88 0.13
89 0.12
90 0.11
91 0.12
92 0.12
93 0.17
94 0.16
95 0.17
96 0.19
97 0.2
98 0.2
99 0.2
100 0.19
101 0.17
102 0.15
103 0.17
104 0.16
105 0.17
106 0.19
107 0.18
108 0.16
109 0.14
110 0.15
111 0.13
112 0.13
113 0.11
114 0.1
115 0.11
116 0.11