Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

M2R1K3

Protein Details
Accession M2R1K3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MAPRKTKKAAKTKRTPSQVKRNTRSHQTRTSPHydrophilic
NLS Segment(s)
PositionSequence
4-16RKTKKAAKTKRTP
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
KEGG bsc:COCSADRAFT_163504  -  
Amino Acid Sequences MAPRKTKKAAKTKRTPSQVKRNTRSHQTRTSPQESPSQNIYIKQEESDETLLTTPGHTTHAHLTPTHKSSSTTYKIKKSTSYPKTPLNAVQSIAMTRCRNSIRRAEFREYVRLGITPLEGKGSGIVQGGQGMTNPLVDEGGEEEIPIIQENSRNELEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.89
4 0.9
5 0.89
6 0.89
7 0.87
8 0.87
9 0.84
10 0.84
11 0.84
12 0.8
13 0.8
14 0.77
15 0.77
16 0.76
17 0.75
18 0.68
19 0.6
20 0.61
21 0.53
22 0.5
23 0.44
24 0.4
25 0.35
26 0.35
27 0.36
28 0.31
29 0.3
30 0.26
31 0.24
32 0.2
33 0.22
34 0.2
35 0.16
36 0.13
37 0.13
38 0.13
39 0.11
40 0.1
41 0.07
42 0.07
43 0.09
44 0.09
45 0.1
46 0.14
47 0.17
48 0.18
49 0.19
50 0.22
51 0.24
52 0.26
53 0.26
54 0.22
55 0.21
56 0.22
57 0.29
58 0.32
59 0.35
60 0.37
61 0.42
62 0.45
63 0.45
64 0.46
65 0.44
66 0.49
67 0.48
68 0.52
69 0.49
70 0.52
71 0.52
72 0.5
73 0.47
74 0.42
75 0.35
76 0.28
77 0.25
78 0.19
79 0.18
80 0.17
81 0.18
82 0.14
83 0.13
84 0.17
85 0.2
86 0.23
87 0.27
88 0.35
89 0.39
90 0.47
91 0.53
92 0.55
93 0.56
94 0.56
95 0.59
96 0.51
97 0.43
98 0.35
99 0.29
100 0.24
101 0.19
102 0.18
103 0.11
104 0.1
105 0.11
106 0.1
107 0.1
108 0.1
109 0.1
110 0.09
111 0.09
112 0.09
113 0.07
114 0.09
115 0.09
116 0.08
117 0.08
118 0.08
119 0.08
120 0.08
121 0.08
122 0.07
123 0.07
124 0.07
125 0.07
126 0.07
127 0.1
128 0.09
129 0.09
130 0.09
131 0.09
132 0.1
133 0.1
134 0.09
135 0.08
136 0.13
137 0.15
138 0.21