Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

M2T8V5

Protein Details
Accession M2T8V5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
78-97HELRRHTNRVHKKVRKVWVTBasic
NLS Segment(s)
PositionSequence
137-152HKRGERKMTAAEARRG
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
KEGG bsc:COCSADRAFT_159311  -  
Amino Acid Sequences MKAGAPPKTPTTTTTTSASEAVEPSPVLRETVVTAPAVDTTPSTSPAFGPSSKTPSRRVLRLKCPVCSDYPDGFRSEHELRRHTNRVHKKVRKVWVTIDTSPDKSFLANCKACQTGKRYNECYNAASHLRRMHFHPHKRGERKMTAAEARRGGKPGDLDPPMDVLKANWLREVDEVLDDGNEPTEEDALNASLSPPQMVSPQSQQQSTSNKSDGQAPPTPTTPSTRSMAIDSIVDKVDAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.33
4 0.33
5 0.31
6 0.24
7 0.21
8 0.18
9 0.16
10 0.13
11 0.12
12 0.14
13 0.14
14 0.13
15 0.12
16 0.12
17 0.14
18 0.16
19 0.17
20 0.14
21 0.13
22 0.13
23 0.14
24 0.14
25 0.11
26 0.09
27 0.11
28 0.12
29 0.15
30 0.15
31 0.14
32 0.14
33 0.18
34 0.2
35 0.18
36 0.22
37 0.23
38 0.3
39 0.35
40 0.38
41 0.4
42 0.47
43 0.52
44 0.54
45 0.61
46 0.62
47 0.67
48 0.74
49 0.73
50 0.67
51 0.66
52 0.6
53 0.53
54 0.49
55 0.45
56 0.39
57 0.39
58 0.36
59 0.33
60 0.31
61 0.28
62 0.3
63 0.29
64 0.3
65 0.31
66 0.33
67 0.36
68 0.43
69 0.5
70 0.48
71 0.53
72 0.58
73 0.63
74 0.71
75 0.74
76 0.76
77 0.77
78 0.82
79 0.77
80 0.69
81 0.64
82 0.61
83 0.59
84 0.51
85 0.48
86 0.41
87 0.37
88 0.35
89 0.3
90 0.22
91 0.17
92 0.17
93 0.16
94 0.22
95 0.22
96 0.22
97 0.24
98 0.26
99 0.26
100 0.28
101 0.3
102 0.3
103 0.36
104 0.42
105 0.43
106 0.46
107 0.5
108 0.49
109 0.43
110 0.35
111 0.31
112 0.28
113 0.25
114 0.23
115 0.23
116 0.22
117 0.22
118 0.25
119 0.32
120 0.38
121 0.45
122 0.52
123 0.57
124 0.65
125 0.71
126 0.74
127 0.71
128 0.66
129 0.63
130 0.56
131 0.51
132 0.48
133 0.46
134 0.44
135 0.41
136 0.39
137 0.35
138 0.34
139 0.3
140 0.25
141 0.22
142 0.21
143 0.22
144 0.21
145 0.2
146 0.19
147 0.21
148 0.19
149 0.18
150 0.15
151 0.09
152 0.17
153 0.2
154 0.2
155 0.2
156 0.2
157 0.21
158 0.22
159 0.23
160 0.15
161 0.12
162 0.12
163 0.09
164 0.09
165 0.08
166 0.08
167 0.07
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.07
175 0.06
176 0.07
177 0.06
178 0.06
179 0.08
180 0.08
181 0.08
182 0.08
183 0.08
184 0.11
185 0.12
186 0.16
187 0.2
188 0.27
189 0.3
190 0.31
191 0.32
192 0.36
193 0.42
194 0.44
195 0.44
196 0.39
197 0.38
198 0.38
199 0.45
200 0.42
201 0.41
202 0.42
203 0.41
204 0.42
205 0.42
206 0.44
207 0.37
208 0.4
209 0.36
210 0.34
211 0.32
212 0.31
213 0.3
214 0.3
215 0.3
216 0.25
217 0.24
218 0.21
219 0.21
220 0.19